BLASTX nr result
ID: Mentha24_contig00009232
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00009232 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42328.1| hypothetical protein MIMGU_mgv1a0171311mg, partia... 81 1e-13 gb|EYU42327.1| hypothetical protein MIMGU_mgv1a0171311mg, partia... 81 1e-13 gb|EYU40336.1| hypothetical protein MIMGU_mgv1a017136mg [Mimulus... 81 1e-13 gb|EXC26760.1| hypothetical protein L484_023376 [Morus notabilis] 81 1e-13 gb|EXB38355.1| 60S ribosomal protein L37a [Morus notabilis] 81 1e-13 ref|XP_006576701.1| PREDICTED: 60S ribosomal protein L37a-like i... 81 1e-13 ref|XP_006358630.1| PREDICTED: 60S ribosomal protein L37a-like [... 81 1e-13 ref|XP_006354681.1| PREDICTED: 60S ribosomal protein L37a-like, ... 81 1e-13 ref|XP_006445465.1| hypothetical protein CICLE_v10022898mg [Citr... 81 1e-13 ref|XP_004508975.1| PREDICTED: 60S ribosomal protein L37a-like i... 81 1e-13 ref|XP_007209764.1| hypothetical protein PRUPE_ppa013350mg [Prun... 81 1e-13 gb|AFW90557.1| 60S ribosomal protein L37a [Solanum tuberosum] 81 1e-13 gb|AFK48860.1| unknown [Medicago truncatula] 81 1e-13 emb|CBI33982.3| unnamed protein product [Vitis vinifera] 81 1e-13 gb|ACU13460.1| unknown [Glycine max] 81 1e-13 ref|XP_002282974.1| PREDICTED: 60S ribosomal protein L37a-like [... 81 1e-13 ref|XP_002517507.1| 60S ribosomal protein L37a, putative [Ricinu... 81 1e-13 ref|XP_002526487.1| 60S ribosomal protein L37a, putative [Ricinu... 81 1e-13 emb|CAI48073.1| 60S ribosomal protein L37a [Capsicum chinense] 81 1e-13 ref|NP_187706.1| putative 60S ribosomal protein L37a-1 [Arabidop... 80 2e-13 >gb|EYU42328.1| hypothetical protein MIMGU_mgv1a0171311mg, partial [Mimulus guttatus] Length = 77 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 40 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 77 >gb|EYU42327.1| hypothetical protein MIMGU_mgv1a0171311mg, partial [Mimulus guttatus] Length = 91 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 54 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 91 >gb|EYU40336.1| hypothetical protein MIMGU_mgv1a017136mg [Mimulus guttatus] Length = 92 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 55 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >gb|EXC26760.1| hypothetical protein L484_023376 [Morus notabilis] Length = 644 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 607 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 644 >gb|EXB38355.1| 60S ribosomal protein L37a [Morus notabilis] Length = 139 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 102 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 139 >ref|XP_006576701.1| PREDICTED: 60S ribosomal protein L37a-like isoform X2 [Glycine max] Length = 105 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 68 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 105 >ref|XP_006358630.1| PREDICTED: 60S ribosomal protein L37a-like [Solanum tuberosum] Length = 99 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 62 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 99 >ref|XP_006354681.1| PREDICTED: 60S ribosomal protein L37a-like, partial [Solanum tuberosum] Length = 124 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 87 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 124 >ref|XP_006445465.1| hypothetical protein CICLE_v10022898mg [Citrus clementina] gi|557547727|gb|ESR58705.1| hypothetical protein CICLE_v10022898mg [Citrus clementina] Length = 121 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 84 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 121 >ref|XP_004508975.1| PREDICTED: 60S ribosomal protein L37a-like isoform X1 [Cicer arietinum] Length = 99 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 62 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 99 >ref|XP_007209764.1| hypothetical protein PRUPE_ppa013350mg [Prunus persica] gi|462405499|gb|EMJ10963.1| hypothetical protein PRUPE_ppa013350mg [Prunus persica] Length = 128 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 91 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 128 >gb|AFW90557.1| 60S ribosomal protein L37a [Solanum tuberosum] Length = 92 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 55 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >gb|AFK48860.1| unknown [Medicago truncatula] Length = 79 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 42 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 79 >emb|CBI33982.3| unnamed protein product [Vitis vinifera] Length = 99 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 62 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 99 >gb|ACU13460.1| unknown [Glycine max] Length = 64 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 27 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 64 >ref|XP_002282974.1| PREDICTED: 60S ribosomal protein L37a-like [Vitis vinifera] gi|449432368|ref|XP_004133971.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|449442329|ref|XP_004138934.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|449461277|ref|XP_004148368.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|449487554|ref|XP_004157684.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|449505246|ref|XP_004162415.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|449524647|ref|XP_004169333.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|460397999|ref|XP_004244552.1| PREDICTED: 60S ribosomal protein L37a-like [Solanum lycopersicum] gi|460400630|ref|XP_004245836.1| PREDICTED: 60S ribosomal protein L37a-like [Solanum lycopersicum] gi|460400632|ref|XP_004245837.1| PREDICTED: 60S ribosomal protein L37a-like [Solanum lycopersicum] gi|460407079|ref|XP_004248984.1| PREDICTED: 60S ribosomal protein L37a-like [Solanum lycopersicum] gi|565357026|ref|XP_006345354.1| PREDICTED: 60S ribosomal protein L37a-like [Solanum tuberosum] gi|565393647|ref|XP_006362483.1| PREDICTED: 60S ribosomal protein L37a-like [Solanum tuberosum] gi|567895310|ref|XP_006440143.1| hypothetical protein CICLE_v10023068mg [Citrus clementina] gi|567905956|ref|XP_006445466.1| hypothetical protein CICLE_v10022898mg [Citrus clementina] gi|568819713|ref|XP_006464390.1| PREDICTED: 60S ribosomal protein L37a-like [Citrus sinensis] gi|568846442|ref|XP_006477063.1| PREDICTED: 60S ribosomal protein L37a-like [Citrus sinensis] gi|590676098|ref|XP_007039638.1| Zinc-binding ribosomal protein family protein [Theobroma cacao] gi|590724193|ref|XP_007052397.1| Zinc-binding ribosomal protein family protein [Theobroma cacao] gi|596012174|ref|XP_007218651.1| hypothetical protein PRUPE_ppa013989mg [Prunus persica] gi|462415113|gb|EMJ19850.1| hypothetical protein PRUPE_ppa013989mg [Prunus persica] gi|508704658|gb|EOX96554.1| Zinc-binding ribosomal protein family protein [Theobroma cacao] gi|508776883|gb|EOY24139.1| Zinc-binding ribosomal protein family protein [Theobroma cacao] gi|557542405|gb|ESR53383.1| hypothetical protein CICLE_v10023068mg [Citrus clementina] gi|557547728|gb|ESR58706.1| hypothetical protein CICLE_v10022898mg [Citrus clementina] Length = 92 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 55 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >ref|XP_002517507.1| 60S ribosomal protein L37a, putative [Ricinus communis] gi|223543518|gb|EEF45049.1| 60S ribosomal protein L37a, putative [Ricinus communis] Length = 110 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 73 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 110 >ref|XP_002526487.1| 60S ribosomal protein L37a, putative [Ricinus communis] gi|356504539|ref|XP_003521053.1| PREDICTED: 60S ribosomal protein L37a-like isoform X1 [Glycine max] gi|356511083|ref|XP_003524259.1| PREDICTED: 60S ribosomal protein L37a [Glycine max] gi|356520742|ref|XP_003529019.1| PREDICTED: 60S ribosomal protein L37a-like [Glycine max] gi|356563414|ref|XP_003549958.1| PREDICTED: 60S ribosomal protein L37a-like [Glycine max] gi|357477067|ref|XP_003608819.1| 60S ribosomal protein L37a [Medicago truncatula] gi|502152546|ref|XP_004508976.1| PREDICTED: 60S ribosomal protein L37a-like isoform X2 [Cicer arietinum] gi|502157216|ref|XP_004510797.1| PREDICTED: 60S ribosomal protein L37a-like [Cicer arietinum] gi|502160454|ref|XP_004511750.1| PREDICTED: 60S ribosomal protein L37a-like [Cicer arietinum] gi|566160676|ref|XP_006385384.1| 60S ribosomal protein L37a [Populus trichocarpa] gi|566161559|ref|XP_006385584.1| hypothetical protein POPTR_0003s08320g [Populus trichocarpa] gi|566202643|ref|XP_006375190.1| hypothetical protein POPTR_0014s05130g [Populus trichocarpa] gi|593264428|ref|XP_007134392.1| hypothetical protein PHAVU_010G044100g [Phaseolus vulgaris] gi|593785373|ref|XP_007155727.1| hypothetical protein PHAVU_003G226400g [Phaseolus vulgaris] gi|118483026|gb|ABK93424.1| unknown [Populus trichocarpa] gi|118484983|gb|ABK94356.1| unknown [Populus trichocarpa] gi|217071074|gb|ACJ83897.1| unknown [Medicago truncatula] gi|223534162|gb|EEF35878.1| 60S ribosomal protein L37a, putative [Ricinus communis] gi|355509874|gb|AES91016.1| 60S ribosomal protein L37a [Medicago truncatula] gi|388494042|gb|AFK35087.1| unknown [Medicago truncatula] gi|388514345|gb|AFK45234.1| unknown [Medicago truncatula] gi|388520787|gb|AFK48455.1| unknown [Medicago truncatula] gi|550323509|gb|ERP52987.1| hypothetical protein POPTR_0014s05130g [Populus trichocarpa] gi|550342327|gb|ERP63181.1| 60S ribosomal protein L37a [Populus trichocarpa] gi|550342711|gb|ERP63381.1| hypothetical protein POPTR_0003s08320g [Populus trichocarpa] gi|561007437|gb|ESW06386.1| hypothetical protein PHAVU_010G044100g [Phaseolus vulgaris] gi|561029081|gb|ESW27721.1| hypothetical protein PHAVU_003G226400g [Phaseolus vulgaris] Length = 92 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 55 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >emb|CAI48073.1| 60S ribosomal protein L37a [Capsicum chinense] Length = 92 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 55 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >ref|NP_187706.1| putative 60S ribosomal protein L37a-1 [Arabidopsis thaliana] gi|20139844|sp|Q9SRK6.1|R37A1_ARATH RecName: Full=Putative 60S ribosomal protein L37a-1 gi|6016699|gb|AAF01526.1|AC009991_22 putative 60S ribosomal protein L37a [Arabidopsis thaliana] gi|332641460|gb|AEE74981.1| large subunit ribosomal protein L37Ae [Arabidopsis thaliana] Length = 92 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 3 WGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 116 WGCKDCGKVKAGGAYT+NTASAVTVRSTIRRLREQTES Sbjct: 55 WGCKDCGKVKAGGAYTMNTASAVTVRSTIRRLREQTES 92