BLASTX nr result
ID: Mentha24_contig00008880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00008880 (497 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24006.1| hypothetical protein MIMGU_mgv1a009524mg [Mimulus... 67 2e-09 >gb|EYU24006.1| hypothetical protein MIMGU_mgv1a009524mg [Mimulus guttatus] Length = 339 Score = 67.4 bits (163), Expect = 2e-09 Identities = 35/55 (63%), Positives = 40/55 (72%), Gaps = 2/55 (3%) Frame = -2 Query: 160 NLY-AGFGSIPSRTQPISPGFSNFTQMV-NEQTVSTVNLNQLTPSQIFQIQAQFH 2 NLY FGS+P + Q SPGFSNF Q+V N Q + +NLN LTPSQI QIQAQFH Sbjct: 67 NLYNTEFGSLPQKAQIFSPGFSNFPQIVDNHQPANQINLNHLTPSQILQIQAQFH 121