BLASTX nr result
ID: Mentha24_contig00008674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00008674 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40077.1| hypothetical protein MIMGU_mgv1a001651mg [Mimulus... 55 8e-06 >gb|EYU40077.1| hypothetical protein MIMGU_mgv1a001651mg [Mimulus guttatus] Length = 778 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 2/31 (6%) Frame = -3 Query: 415 STGQKKLH-QMKS-KPKDPTKRHQLFKKRFG 329 STGQKKLH QMKS KPKDPTKRHQLFKKRFG Sbjct: 748 STGQKKLHGQMKSNKPKDPTKRHQLFKKRFG 778