BLASTX nr result
ID: Mentha24_contig00008591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00008591 (494 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37954.1| hypothetical protein MIMGU_mgv1a011243mg [Mimulus... 92 6e-17 gb|ACI90291.1| putative bZIP transcription factor [Picrorhiza ku... 73 4e-11 ref|XP_002534148.1| DNA binding protein, putative [Ricinus commu... 66 4e-09 gb|AFP19453.1| bZIP transcription factor family protein 2 [Camel... 64 2e-08 gb|AFP19452.1| bZIP transcription factor family protein 1 [Camel... 64 2e-08 ref|XP_004231042.1| PREDICTED: uncharacterized protein LOC101266... 63 4e-08 ref|XP_004231041.1| PREDICTED: uncharacterized protein LOC101266... 63 4e-08 ref|XP_004147043.1| PREDICTED: uncharacterized protein LOC101219... 63 5e-08 ref|XP_006359698.1| PREDICTED: uncharacterized protein LOC102599... 62 8e-08 ref|XP_006422601.1| hypothetical protein CICLE_v10028931mg [Citr... 61 1e-07 ref|XP_006422593.1| hypothetical protein CICLE_v10028931mg [Citr... 61 1e-07 ref|XP_002278836.1| PREDICTED: uncharacterized protein LOC100243... 61 2e-07 emb|CAN73631.1| hypothetical protein VITISV_026643 [Vitis vinifera] 61 2e-07 ref|XP_007041828.1| Basic-leucine zipper transcription factor fa... 60 4e-07 ref|XP_007041827.1| Basic-leucine zipper transcription factor fa... 60 4e-07 ref|XP_007041826.1| Basic-leucine zipper transcription factor fa... 60 4e-07 gb|EXC16577.1| hypothetical protein L484_008383 [Morus notabilis] 59 7e-07 ref|XP_004164905.1| PREDICTED: uncharacterized protein LOC101232... 56 6e-06 ref|XP_004144846.1| PREDICTED: uncharacterized protein LOC101208... 56 6e-06 >gb|EYU37954.1| hypothetical protein MIMGU_mgv1a011243mg [Mimulus guttatus] Length = 288 Score = 92.4 bits (228), Expect = 6e-17 Identities = 41/79 (51%), Positives = 49/79 (62%) Frame = +1 Query: 1 VHGRYVISTCNVQRNDPLYCVHPGSEAGLSGQGLVDCGFDNLQCSGNLNSEPDEFPDCXX 180 + G YV++ CN+QRN+ LYC+HPGSE SGQGL DCGFD+LQC GN NS P E PDC Sbjct: 202 IQGTYVMNPCNMQRNEQLYCLHPGSETAFSGQGLGDCGFDDLQCLGNQNSNPMELPDCGF 261 Query: 181 XXXXXXXXXXXXXXXKRKG 237 K+KG Sbjct: 262 DNVNIASNANTSSSSKKKG 280 >gb|ACI90291.1| putative bZIP transcription factor [Picrorhiza kurrooa] Length = 289 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/57 (61%), Positives = 41/57 (71%), Gaps = 4/57 (7%) Frame = +1 Query: 13 YVISTCNVQRNDPLYCVHPGSEAG----LSGQGLVDCGFDNLQCSGNLNSEPDEFPD 171 YV++ CN+QRNDPLYC++ GSE LSGQGL DCGFDNLQC G+ NS E D Sbjct: 206 YVMNPCNMQRNDPLYCLYSGSETALNGQLSGQGLGDCGFDNLQCLGDQNSIQKELLD 262 >ref|XP_002534148.1| DNA binding protein, putative [Ricinus communis] gi|223525783|gb|EEF28231.1| DNA binding protein, putative [Ricinus communis] Length = 284 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 6/62 (9%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSEA------GLSGQGLVDCGFDNLQCSGNLNSEPDEFP 168 G YV++ CN+Q ND +YC+HPG + L+GQG C FDNLQC N NS E P Sbjct: 182 GAYVMNPCNMQCNDQVYCLHPGVDGRSDDGIALNGQGFNGCDFDNLQCLANQNSAAKELP 241 Query: 169 DC 174 C Sbjct: 242 SC 243 >gb|AFP19453.1| bZIP transcription factor family protein 2 [Camellia sinensis] Length = 270 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/62 (48%), Positives = 39/62 (62%), Gaps = 6/62 (9%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSE------AGLSGQGLVDCGFDNLQCSGNLNSEPDEFP 168 G YV+S CNVQ +D +YC+ PG+E A ++GQG C F+NLQC GN N+ E P Sbjct: 184 GAYVMSPCNVQCDDQVYCLQPGAESKSGEDASINGQGFSGCEFENLQCLGNENAGLKELP 243 Query: 169 DC 174 C Sbjct: 244 GC 245 >gb|AFP19452.1| bZIP transcription factor family protein 1 [Camellia sinensis] Length = 270 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/62 (48%), Positives = 39/62 (62%), Gaps = 6/62 (9%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSE------AGLSGQGLVDCGFDNLQCSGNLNSEPDEFP 168 G YV+S CNVQ +D +YC+ PG+E A ++GQG C F+NLQC GN N+ E P Sbjct: 184 GAYVMSPCNVQCDDQVYCLQPGAESKSGEDASINGQGFSGCEFENLQCLGNENAGLKELP 243 Query: 169 DC 174 C Sbjct: 244 GC 245 >ref|XP_004231042.1| PREDICTED: uncharacterized protein LOC101266077 isoform 2 [Solanum lycopersicum] Length = 270 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/62 (45%), Positives = 40/62 (64%), Gaps = 6/62 (9%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSEAG------LSGQGLVDCGFDNLQCSGNLNSEPDEFP 168 G YV+++CN+Q +D +YC+HPG+E L+GQG +C F+ LQC GN S +E P Sbjct: 184 GAYVVNSCNLQCDDQVYCLHPGAEGKNSDGTVLNGQGFNNCEFETLQCLGNQTSGLEEVP 243 Query: 169 DC 174 C Sbjct: 244 GC 245 >ref|XP_004231041.1| PREDICTED: uncharacterized protein LOC101266077 isoform 1 [Solanum lycopersicum] Length = 277 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/62 (45%), Positives = 40/62 (64%), Gaps = 6/62 (9%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSEAG------LSGQGLVDCGFDNLQCSGNLNSEPDEFP 168 G YV+++CN+Q +D +YC+HPG+E L+GQG +C F+ LQC GN S +E P Sbjct: 184 GAYVVNSCNLQCDDQVYCLHPGAEGKNSDGTVLNGQGFNNCEFETLQCLGNQTSGLEEVP 243 Query: 169 DC 174 C Sbjct: 244 GC 245 >ref|XP_004147043.1| PREDICTED: uncharacterized protein LOC101219501 [Cucumis sativus] gi|449489648|ref|XP_004158374.1| PREDICTED: uncharacterized LOC101219501 [Cucumis sativus] Length = 273 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/64 (46%), Positives = 38/64 (59%), Gaps = 6/64 (9%) Frame = +1 Query: 1 VHGRYVISTCNVQRNDPLYCVHPGSE------AGLSGQGLVDCGFDNLQCSGNLNSEPDE 162 V G Y+I+ CNV+ ND YC+HPG + A L+GQ C F+NLQC N N+ E Sbjct: 179 VSGSYMINPCNVECNDQAYCLHPGDDGKSGESALLNGQSFSACDFENLQCLANQNTGAKE 238 Query: 163 FPDC 174 PDC Sbjct: 239 PPDC 242 >ref|XP_006359698.1| PREDICTED: uncharacterized protein LOC102599645 [Solanum tuberosum] Length = 272 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/62 (43%), Positives = 40/62 (64%), Gaps = 6/62 (9%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSEAG------LSGQGLVDCGFDNLQCSGNLNSEPDEFP 168 G YV+++CN+Q +D +YC+HPG+E L+GQG +C F+ LQC GN + +E P Sbjct: 184 GAYVVNSCNLQCDDQVYCLHPGAEGKSSDGTVLNGQGFNNCEFETLQCLGNQTTGLEEVP 243 Query: 169 DC 174 C Sbjct: 244 GC 245 >ref|XP_006422601.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|557524535|gb|ESR35841.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] Length = 302 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 6/62 (9%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSE------AGLSGQGLVDCGFDNLQCSGNLNSEPDEFP 168 G YV++ CN++ +D +YC+HPG E L+GQG C F+NLQC GN +S E P Sbjct: 180 GAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVRELP 239 Query: 169 DC 174 C Sbjct: 240 GC 241 >ref|XP_006422593.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|567859880|ref|XP_006422594.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|567859882|ref|XP_006422595.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|567859884|ref|XP_006422596.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|567859886|ref|XP_006422597.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|567859888|ref|XP_006422598.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|567859890|ref|XP_006422599.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|567859892|ref|XP_006422600.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|568866805|ref|XP_006486739.1| PREDICTED: uncharacterized protein LOC102628933 isoform X1 [Citrus sinensis] gi|568866807|ref|XP_006486740.1| PREDICTED: uncharacterized protein LOC102628933 isoform X2 [Citrus sinensis] gi|568866809|ref|XP_006486741.1| PREDICTED: uncharacterized protein LOC102628933 isoform X3 [Citrus sinensis] gi|557524527|gb|ESR35833.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|557524528|gb|ESR35834.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|557524529|gb|ESR35835.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|557524530|gb|ESR35836.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|557524531|gb|ESR35837.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|557524532|gb|ESR35838.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|557524533|gb|ESR35839.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] gi|557524534|gb|ESR35840.1| hypothetical protein CICLE_v10028931mg [Citrus clementina] Length = 268 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 6/62 (9%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSE------AGLSGQGLVDCGFDNLQCSGNLNSEPDEFP 168 G YV++ CN++ +D +YC+HPG E L+GQG C F+NLQC GN +S E P Sbjct: 180 GAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVRELP 239 Query: 169 DC 174 C Sbjct: 240 GC 241 >ref|XP_002278836.1| PREDICTED: uncharacterized protein LOC100243471 [Vitis vinifera] Length = 273 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/62 (43%), Positives = 39/62 (62%), Gaps = 6/62 (9%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSEA------GLSGQGLVDCGFDNLQCSGNLNSEPDEFP 168 G +V++ CN+Q +D +YC+HPG EA GL+GQG C F+N+ C GN ++ E P Sbjct: 188 GAFVMNPCNLQCDDQVYCLHPGVEAKNGEAAGLNGQGFNGCDFENIPCVGNPSAALKELP 247 Query: 169 DC 174 C Sbjct: 248 GC 249 >emb|CAN73631.1| hypothetical protein VITISV_026643 [Vitis vinifera] Length = 264 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/62 (43%), Positives = 39/62 (62%), Gaps = 6/62 (9%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSEA------GLSGQGLVDCGFDNLQCSGNLNSEPDEFP 168 G +V++ CN+Q +D +YC+HPG EA GL+GQG C F+N+ C GN ++ E P Sbjct: 186 GAFVMNPCNLQCDDQVYCLHPGVEAKNGEAAGLNGQGFNGCDFENIPCVGNPSAALKELP 245 Query: 169 DC 174 C Sbjct: 246 GC 247 >ref|XP_007041828.1| Basic-leucine zipper transcription factor family protein isoform 3 [Theobroma cacao] gi|508705763|gb|EOX97659.1| Basic-leucine zipper transcription factor family protein isoform 3 [Theobroma cacao] Length = 281 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 6/58 (10%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSE------AGLSGQGLVDCGFDNLQCSGNLNSEPDE 162 G YV++ CNVQ ND +YC+HPG++ A L+GQG C FDNL C N NS E Sbjct: 179 GAYVMNPCNVQCNDQMYCLHPGADGKTGEVAELNGQGFNVCEFDNLPCLANQNSGEKE 236 >ref|XP_007041827.1| Basic-leucine zipper transcription factor family protein isoform 2 [Theobroma cacao] gi|508705762|gb|EOX97658.1| Basic-leucine zipper transcription factor family protein isoform 2 [Theobroma cacao] Length = 310 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 6/58 (10%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSE------AGLSGQGLVDCGFDNLQCSGNLNSEPDE 162 G YV++ CNVQ ND +YC+HPG++ A L+GQG C FDNL C N NS E Sbjct: 179 GAYVMNPCNVQCNDQMYCLHPGADGKTGEVAELNGQGFNVCEFDNLPCLANQNSGEKE 236 >ref|XP_007041826.1| Basic-leucine zipper transcription factor family protein isoform 1 [Theobroma cacao] gi|590684354|ref|XP_007041829.1| Basic-leucine zipper transcription factor family protein isoform 1 [Theobroma cacao] gi|590684357|ref|XP_007041830.1| Basic-leucine zipper transcription factor family protein isoform 1 [Theobroma cacao] gi|590684361|ref|XP_007041831.1| Basic-leucine zipper transcription factor family protein isoform 1 [Theobroma cacao] gi|508705761|gb|EOX97657.1| Basic-leucine zipper transcription factor family protein isoform 1 [Theobroma cacao] gi|508705764|gb|EOX97660.1| Basic-leucine zipper transcription factor family protein isoform 1 [Theobroma cacao] gi|508705765|gb|EOX97661.1| Basic-leucine zipper transcription factor family protein isoform 1 [Theobroma cacao] gi|508705766|gb|EOX97662.1| Basic-leucine zipper transcription factor family protein isoform 1 [Theobroma cacao] Length = 266 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 6/58 (10%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSE------AGLSGQGLVDCGFDNLQCSGNLNSEPDE 162 G YV++ CNVQ ND +YC+HPG++ A L+GQG C FDNL C N NS E Sbjct: 179 GAYVMNPCNVQCNDQMYCLHPGADGKTGEVAELNGQGFNVCEFDNLPCLANQNSGEKE 236 >gb|EXC16577.1| hypothetical protein L484_008383 [Morus notabilis] Length = 262 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/61 (44%), Positives = 37/61 (60%), Gaps = 5/61 (8%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSE-----AGLSGQGLVDCGFDNLQCSGNLNSEPDEFPD 171 G YV++ CN+Q +D +YC+HPG + A L+GQ C F++LQC N NS E P Sbjct: 182 GAYVMNPCNMQCDDQVYCLHPGMDGKCDGAVLNGQSFSGCEFESLQCLANQNSGSKELPG 241 Query: 172 C 174 C Sbjct: 242 C 242 >ref|XP_004164905.1| PREDICTED: uncharacterized protein LOC101232700 [Cucumis sativus] Length = 262 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/63 (41%), Positives = 35/63 (55%), Gaps = 7/63 (11%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSEAGLSGQGLV-------DCGFDNLQCSGNLNSEPDEF 165 G YV++ CN+Q D +YC+HPG + S +G V C F+NLQC N +S E Sbjct: 181 GAYVMNPCNMQCEDQVYCLHPGVDGSRSSEGAVINGQSFGACEFENLQCLANHDSGSKEL 240 Query: 166 PDC 174 P C Sbjct: 241 PGC 243 >ref|XP_004144846.1| PREDICTED: uncharacterized protein LOC101208161 [Cucumis sativus] Length = 270 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/63 (41%), Positives = 35/63 (55%), Gaps = 7/63 (11%) Frame = +1 Query: 7 GRYVISTCNVQRNDPLYCVHPGSEAGLSGQGLV-------DCGFDNLQCSGNLNSEPDEF 165 G YV++ CN+Q D +YC+HPG + S +G V C F+NLQC N +S E Sbjct: 181 GAYVMNPCNMQCEDQVYCLHPGVDGSRSSEGAVINGQSFGACEFENLQCLANHDSGSKEL 240 Query: 166 PDC 174 P C Sbjct: 241 PGC 243