BLASTX nr result
ID: Mentha24_contig00008254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00008254 (440 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41916.1| hypothetical protein MIMGU_mgv1a005306mg [Mimulus... 65 8e-09 ref|XP_002532113.1| acyl-CoA dehydrogenase, putative [Ricinus co... 63 5e-08 ref|XP_004302546.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxi... 60 2e-07 gb|AAT11172.1| putative short-chain acyl-CoA oxidase [Tropaeolum... 60 2e-07 ref|XP_007207462.1| hypothetical protein PRUPE_ppa005916mg [Prun... 60 4e-07 ref|XP_003632582.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxi... 60 4e-07 ref|XP_002264086.2| PREDICTED: acyl-coenzyme A oxidase 4, peroxi... 60 4e-07 ref|XP_002322987.2| hypothetical protein POPTR_0016s12540g [Popu... 59 5e-07 ref|XP_004137705.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxi... 59 5e-07 ref|XP_006481057.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxi... 59 7e-07 ref|XP_006429420.1| hypothetical protein CICLE_v100119341mg, par... 59 7e-07 ref|XP_002308225.1| ACYL-COA oxidase 4 family protein [Populus t... 58 1e-06 ref|XP_007026667.1| Acyl-CoA oxidase 4 [Theobroma cacao] gi|5087... 58 2e-06 gb|EXB99423.1| Acyl-coenzyme A oxidase 4 [Morus notabilis] 56 5e-06 ref|XP_001767636.1| predicted protein [Physcomitrella patens] gi... 56 5e-06 gb|EPS73556.1| hypothetical protein M569_01198, partial [Genlise... 56 6e-06 ref|NP_190752.1| acyl-coenzyme A oxidase 4 [Arabidopsis thaliana... 55 8e-06 pdb|2IX6|A Chain A, Short Chain Specific Acyl-Coa Oxidase From A... 55 8e-06 dbj|BAD95143.1| Short-chain acyl CoA oxidase [Arabidopsis thaliana] 55 8e-06 >gb|EYU41916.1| hypothetical protein MIMGU_mgv1a005306mg [Mimulus guttatus] Length = 489 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGTYDINTLVTGREITGI+S KP SSNRSRL Sbjct: 455 YTYEGTYDINTLVTGREITGIASFKPAASSNRSRL 489 >ref|XP_002532113.1| acyl-CoA dehydrogenase, putative [Ricinus communis] gi|223528216|gb|EEF30275.1| acyl-CoA dehydrogenase, putative [Ricinus communis] Length = 440 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGTYDINTLVTGRE+TGI+S KP SNRSRL Sbjct: 406 YTYEGTYDINTLVTGREVTGIASFKPAALSNRSRL 440 >ref|XP_004302546.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxisomal-like [Fragaria vesca subsp. vesca] Length = 435 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGTYDIN+LVTGREITG++S KP SS RSRL Sbjct: 401 YTYEGTYDINSLVTGREITGVASFKPAPSSKRSRL 435 >gb|AAT11172.1| putative short-chain acyl-CoA oxidase [Tropaeolum majus] Length = 440 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGT+DINTLVTGRE+TG++S KP SS RSRL Sbjct: 406 YTYEGTFDINTLVTGREVTGLASFKPATSSQRSRL 440 >ref|XP_007207462.1| hypothetical protein PRUPE_ppa005916mg [Prunus persica] gi|402715756|gb|AFQ93696.1| acyl-CoA oxidase 4 [Prunus persica] gi|462403104|gb|EMJ08661.1| hypothetical protein PRUPE_ppa005916mg [Prunus persica] Length = 437 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YT+EGTYDIN LVTGREITGI+S KP SS RSRL Sbjct: 403 YTFEGTYDINALVTGREITGIASFKPAASSQRSRL 437 >ref|XP_003632582.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxisomal-like isoform 2 [Vitis vinifera] Length = 439 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGTYDINTLVTGREITGI+S KP + RSRL Sbjct: 405 YTYEGTYDINTLVTGREITGIASFKPAALNRRSRL 439 >ref|XP_002264086.2| PREDICTED: acyl-coenzyme A oxidase 4, peroxisomal-like isoform 1 [Vitis vinifera] gi|296083170|emb|CBI22806.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGTYDINTLVTGREITGI+S KP + RSRL Sbjct: 412 YTYEGTYDINTLVTGREITGIASFKPAALNRRSRL 446 >ref|XP_002322987.2| hypothetical protein POPTR_0016s12540g [Populus trichocarpa] gi|550321357|gb|EEF04748.2| hypothetical protein POPTR_0016s12540g [Populus trichocarpa] Length = 502 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGTYDIN+LVTGREITG++S KP + S RSRL Sbjct: 468 YTYEGTYDINSLVTGREITGLASFKPAMLSKRSRL 502 >ref|XP_004137705.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxisomal-like [Cucumis sativus] gi|449483509|ref|XP_004156611.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxisomal-like [Cucumis sativus] Length = 440 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGTYDINTLVTGREITG++S KP + RSRL Sbjct: 406 YTYEGTYDINTLVTGREITGVASFKPAALAKRSRL 440 >ref|XP_006481057.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxisomal-like [Citrus sinensis] Length = 439 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGTYDINTLVTGRE+TGI+S KP + RSRL Sbjct: 405 YTYEGTYDINTLVTGREVTGIASFKPVALATRSRL 439 >ref|XP_006429420.1| hypothetical protein CICLE_v100119341mg, partial [Citrus clementina] gi|557531477|gb|ESR42660.1| hypothetical protein CICLE_v100119341mg, partial [Citrus clementina] Length = 47 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGTYDINTLVTGRE+TGI+S KP + RSRL Sbjct: 13 YTYEGTYDINTLVTGREVTGIASFKPVALATRSRL 47 >ref|XP_002308225.1| ACYL-COA oxidase 4 family protein [Populus trichocarpa] gi|222854201|gb|EEE91748.1| ACYL-COA oxidase 4 family protein [Populus trichocarpa] Length = 436 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGTYDIN+L+TGREITG++S KP + S RSR+ Sbjct: 402 YTYEGTYDINSLITGREITGLASFKPAMLSKRSRM 436 >ref|XP_007026667.1| Acyl-CoA oxidase 4 [Theobroma cacao] gi|508715272|gb|EOY07169.1| Acyl-CoA oxidase 4 [Theobroma cacao] Length = 477 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGTYDIN+LVTGREITG +S KP S RSRL Sbjct: 443 YTYEGTYDINSLVTGREITGFASFKPAALSQRSRL 477 >gb|EXB99423.1| Acyl-coenzyme A oxidase 4 [Morus notabilis] Length = 439 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGTY+IN+LV GRE+TG +S KP SS RSRL Sbjct: 405 YTYEGTYEINSLVAGREVTGFASFKPSASSQRSRL 439 >ref|XP_001767636.1| predicted protein [Physcomitrella patens] gi|162681165|gb|EDQ67595.1| predicted protein [Physcomitrella patens] Length = 375 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPIS 89 YTYEGTYDINTLVTGREITGI+SIKP S Sbjct: 336 YTYEGTYDINTLVTGREITGIASIKPSAS 364 >gb|EPS73556.1| hypothetical protein M569_01198, partial [Genlisea aurea] Length = 431 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/37 (78%), Positives = 31/37 (83%), Gaps = 2/37 (5%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPIS--SNRSRL 107 YTYEGTYDINTLVTGREITGI+S KP S S +SRL Sbjct: 395 YTYEGTYDINTLVTGREITGIASFKPSSSGFSAKSRL 431 >ref|NP_190752.1| acyl-coenzyme A oxidase 4 [Arabidopsis thaliana] gi|62286630|sp|Q96329.1|ACOX4_ARATH RecName: Full=Acyl-coenzyme A oxidase 4, peroxisomal; Short=AOX 4; AltName: Full=G6p; AltName: Full=Short-chain acyl-CoA oxidase; Short=AtCX4; Short=AtG6; Short=SAOX gi|114794822|pdb|2IX5|A Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 In Complex With Acetoacetyl-Coa gi|114794823|pdb|2IX5|B Chain B, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 In Complex With Acetoacetyl-Coa gi|114794824|pdb|2IX5|C Chain C, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 In Complex With Acetoacetyl-Coa gi|114794825|pdb|2IX5|D Chain D, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 In Complex With Acetoacetyl-Coa gi|1657621|gb|AAB18129.1| G6p [Arabidopsis thaliana] gi|3068711|gb|AAC14411.1| putative acyl-coA dehydrogenase [Arabidopsis thaliana] gi|5478795|dbj|BAA82478.1| Short-chain acyl CoA oxidase [Arabidopsis thaliana] gi|20453143|gb|AAM19813.1| At3g51840/AtG6 [Arabidopsis thaliana] gi|21593380|gb|AAM65329.1| acyl-coA dehydrogenase [Arabidopsis thaliana] gi|21928035|gb|AAM78046.1| At3g51840/AtG6 [Arabidopsis thaliana] gi|332645330|gb|AEE78851.1| acyl-coenzyme A oxidase 4 [Arabidopsis thaliana] Length = 436 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGTYDINTLVTGRE+TGI+S KP + RSRL Sbjct: 405 YTYEGTYDINTLVTGREVTGIASFKP---ATRSRL 436 >pdb|2IX6|A Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 gi|114794827|pdb|2IX6|B Chain B, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 gi|114794828|pdb|2IX6|C Chain C, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 gi|114794829|pdb|2IX6|D Chain D, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 gi|114794830|pdb|2IX6|E Chain E, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 gi|114794831|pdb|2IX6|F Chain F, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 Length = 449 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGTYDINTLVTGRE+TGI+S KP + RSRL Sbjct: 405 YTYEGTYDINTLVTGREVTGIASFKP---ATRSRL 436 >dbj|BAD95143.1| Short-chain acyl CoA oxidase [Arabidopsis thaliana] Length = 185 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 3 YTYEGTYDINTLVTGREITGISSIKPPISSNRSRL 107 YTYEGTYDINTLVTGRE+TGI+S KP + RSRL Sbjct: 154 YTYEGTYDINTLVTGREVTGIASFKP---ATRSRL 185