BLASTX nr result
ID: Mentha24_contig00008203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00008203 (1126 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43391.1| hypothetical protein MIMGU_mgv1a001292mg [Mimulus... 60 1e-06 >gb|EYU43391.1| hypothetical protein MIMGU_mgv1a001292mg [Mimulus guttatus] Length = 846 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +3 Query: 1011 LYGPQASTIFSSLEESIQKIDDLLMFERGFSNGDVVCL 1124 +Y +A +IFS+LEE+I+KIDD L+FERGFSNGD+VCL Sbjct: 26 IYNGRARSIFSNLEETIEKIDDFLLFERGFSNGDIVCL 63