BLASTX nr result
ID: Mentha24_contig00008015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00008015 (561 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35037.1| hypothetical protein MIMGU_mgv1a000315mg [Mimulus... 135 9e-30 ref|XP_004172325.1| PREDICTED: cullin-associated NEDD8-dissociat... 127 2e-27 ref|XP_004133735.1| PREDICTED: cullin-associated NEDD8-dissociat... 127 2e-27 ref|XP_007220298.1| hypothetical protein PRUPE_ppa000384mg [Prun... 126 4e-27 ref|XP_002527826.1| tip120, putative [Ricinus communis] gi|22353... 126 4e-27 ref|XP_006584133.1| PREDICTED: cullin-associated NEDD8-dissociat... 125 6e-27 ref|XP_007153920.1| hypothetical protein PHAVU_003G076300g [Phas... 125 6e-27 ref|XP_007023141.1| Cullin-associated and neddylation dissociate... 125 6e-27 ref|XP_003550095.1| PREDICTED: cullin-associated NEDD8-dissociat... 125 6e-27 emb|CBI29634.3| unnamed protein product [Vitis vinifera] 125 6e-27 ref|XP_003633418.1| PREDICTED: cullin-associated NEDD8-dissociat... 125 6e-27 gb|EPS63633.1| hypothetical protein M569_11150 [Genlisea aurea] 123 3e-26 ref|XP_004499362.1| PREDICTED: cullin-associated NEDD8-dissociat... 123 4e-26 ref|XP_006385092.1| TIP120 family protein [Populus trichocarpa] ... 122 6e-26 ref|XP_006349276.1| PREDICTED: cullin-associated NEDD8-dissociat... 120 3e-25 ref|XP_002303150.2| TIP120 family protein [Populus trichocarpa] ... 119 4e-25 gb|EXC26457.1| hypothetical protein L484_001858 [Morus notabilis] 119 5e-25 ref|XP_006431436.1| hypothetical protein CICLE_v10000063mg [Citr... 118 9e-25 ref|XP_004307881.1| PREDICTED: cullin-associated NEDD8-dissociat... 115 6e-24 ref|XP_004230412.1| PREDICTED: cullin-associated NEDD8-dissociat... 112 8e-23 >gb|EYU35037.1| hypothetical protein MIMGU_mgv1a000315mg [Mimulus guttatus] Length = 1264 Score = 135 bits (339), Expect = 9e-30 Identities = 67/73 (91%), Positives = 70/73 (95%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINFRPKQDAVKQE+DRNEDMIRSA RAIASLNRISGGDCS+KFKNLM+EIAKS Sbjct: 1192 VDPLQKTINFRPKQDAVKQEIDRNEDMIRSALRAIASLNRISGGDCSHKFKNLMSEIAKS 1251 Query: 379 STLSEKYSSIRNE 341 TLSEKYSSIRNE Sbjct: 1252 HTLSEKYSSIRNE 1264 >ref|XP_004172325.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like, partial [Cucumis sativus] Length = 390 Score = 127 bits (319), Expect = 2e-27 Identities = 64/73 (87%), Positives = 66/73 (90%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINF+PKQDAVKQEVDRNEDMIRSA RAIASLNRISGGDCS KFKNLM EI+KS Sbjct: 318 VDPLQKTINFKPKQDAVKQEVDRNEDMIRSALRAIASLNRISGGDCSLKFKNLMNEISKS 377 Query: 379 STLSEKYSSIRNE 341 LSEKY SIRNE Sbjct: 378 PALSEKYYSIRNE 390 >ref|XP_004133735.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Cucumis sativus] Length = 1218 Score = 127 bits (319), Expect = 2e-27 Identities = 64/73 (87%), Positives = 66/73 (90%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINF+PKQDAVKQEVDRNEDMIRSA RAIASLNRISGGDCS KFKNLM EI+KS Sbjct: 1146 VDPLQKTINFKPKQDAVKQEVDRNEDMIRSALRAIASLNRISGGDCSLKFKNLMNEISKS 1205 Query: 379 STLSEKYSSIRNE 341 LSEKY SIRNE Sbjct: 1206 PALSEKYYSIRNE 1218 >ref|XP_007220298.1| hypothetical protein PRUPE_ppa000384mg [Prunus persica] gi|462416760|gb|EMJ21497.1| hypothetical protein PRUPE_ppa000384mg [Prunus persica] Length = 1222 Score = 126 bits (316), Expect = 4e-27 Identities = 63/73 (86%), Positives = 67/73 (91%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINF+PKQDAVKQEVDRNEDMIRSA RAIASL+RISGGDCS KFKNLM EI+KS Sbjct: 1150 VDPLQKTINFKPKQDAVKQEVDRNEDMIRSALRAIASLHRISGGDCSLKFKNLMNEISKS 1209 Query: 379 STLSEKYSSIRNE 341 TLS+KY SIRNE Sbjct: 1210 PTLSDKYYSIRNE 1222 >ref|XP_002527826.1| tip120, putative [Ricinus communis] gi|223532750|gb|EEF34529.1| tip120, putative [Ricinus communis] Length = 1218 Score = 126 bits (316), Expect = 4e-27 Identities = 62/73 (84%), Positives = 67/73 (91%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KT+NF+PKQDAVKQEVDRNEDMIRSA RAIA+LNRISGGDCS+KFKNLM EI+KS Sbjct: 1146 VDPLQKTVNFKPKQDAVKQEVDRNEDMIRSALRAIAALNRISGGDCSHKFKNLMNEISKS 1205 Query: 379 STLSEKYSSIRNE 341 TL EKY SIRNE Sbjct: 1206 PTLWEKYYSIRNE 1218 >ref|XP_006584133.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Glycine max] Length = 1217 Score = 125 bits (315), Expect = 6e-27 Identities = 63/73 (86%), Positives = 66/73 (90%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINF+PKQDAVKQEVDRNEDMIRSA RAIASLNRISGGDCS KFKNLM EI+KS Sbjct: 1145 VDPLQKTINFKPKQDAVKQEVDRNEDMIRSALRAIASLNRISGGDCSVKFKNLMNEISKS 1204 Query: 379 STLSEKYSSIRNE 341 TL +KY SIRNE Sbjct: 1205 QTLWDKYYSIRNE 1217 >ref|XP_007153920.1| hypothetical protein PHAVU_003G076300g [Phaseolus vulgaris] gi|561027274|gb|ESW25914.1| hypothetical protein PHAVU_003G076300g [Phaseolus vulgaris] Length = 1218 Score = 125 bits (315), Expect = 6e-27 Identities = 63/73 (86%), Positives = 66/73 (90%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINF+PKQDAVKQEVDRNEDMIRSA RAIASLNRISGGDCS KFKNLM EI+KS Sbjct: 1146 VDPLQKTINFKPKQDAVKQEVDRNEDMIRSALRAIASLNRISGGDCSVKFKNLMNEISKS 1205 Query: 379 STLSEKYSSIRNE 341 TL +KY SIRNE Sbjct: 1206 QTLWDKYYSIRNE 1218 >ref|XP_007023141.1| Cullin-associated and neddylation dissociated [Theobroma cacao] gi|508778507|gb|EOY25763.1| Cullin-associated and neddylation dissociated [Theobroma cacao] Length = 1218 Score = 125 bits (315), Expect = 6e-27 Identities = 63/73 (86%), Positives = 67/73 (91%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINF+PKQDAVKQEVDRNEDMIRSA RAIASLNRISGGDCS KFKNLM+EI+KS Sbjct: 1146 VDPLQKTINFKPKQDAVKQEVDRNEDMIRSALRAIASLNRISGGDCSLKFKNLMSEISKS 1205 Query: 379 STLSEKYSSIRNE 341 TL +KY SIRNE Sbjct: 1206 PTLWDKYYSIRNE 1218 >ref|XP_003550095.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Glycine max] Length = 1218 Score = 125 bits (315), Expect = 6e-27 Identities = 63/73 (86%), Positives = 66/73 (90%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINF+PKQDAVKQEVDRNEDMIRSA RAIASLNRISGGDCS KFKNLM EI+KS Sbjct: 1146 VDPLQKTINFKPKQDAVKQEVDRNEDMIRSALRAIASLNRISGGDCSVKFKNLMNEISKS 1205 Query: 379 STLSEKYSSIRNE 341 TL +KY SIRNE Sbjct: 1206 QTLWDKYYSIRNE 1218 >emb|CBI29634.3| unnamed protein product [Vitis vinifera] Length = 1245 Score = 125 bits (315), Expect = 6e-27 Identities = 64/73 (87%), Positives = 67/73 (91%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINF+PKQDAVKQEVDRNEDMIRSA RAIASLNRISGGDCS KFK+LM EI+KS Sbjct: 1173 VDPLLKTINFKPKQDAVKQEVDRNEDMIRSALRAIASLNRISGGDCSLKFKHLMNEISKS 1232 Query: 379 STLSEKYSSIRNE 341 STL EKY SIRNE Sbjct: 1233 STLWEKYHSIRNE 1245 >ref|XP_003633418.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Vitis vinifera] Length = 1218 Score = 125 bits (315), Expect = 6e-27 Identities = 64/73 (87%), Positives = 67/73 (91%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINF+PKQDAVKQEVDRNEDMIRSA RAIASLNRISGGDCS KFK+LM EI+KS Sbjct: 1146 VDPLLKTINFKPKQDAVKQEVDRNEDMIRSALRAIASLNRISGGDCSLKFKHLMNEISKS 1205 Query: 379 STLSEKYSSIRNE 341 STL EKY SIRNE Sbjct: 1206 STLWEKYHSIRNE 1218 >gb|EPS63633.1| hypothetical protein M569_11150 [Genlisea aurea] Length = 1222 Score = 123 bits (309), Expect = 3e-26 Identities = 61/73 (83%), Positives = 66/73 (90%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 V+PL KTI+FRPKQDAVKQEVDRNEDMIRSA R I+SLNRISGG+CS+K KNLM EIAKS Sbjct: 1150 VEPLQKTISFRPKQDAVKQEVDRNEDMIRSALRGISSLNRISGGECSHKLKNLMNEIAKS 1209 Query: 379 STLSEKYSSIRNE 341 LSEKYSSIRNE Sbjct: 1210 QALSEKYSSIRNE 1222 >ref|XP_004499362.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Cicer arietinum] Length = 1218 Score = 123 bits (308), Expect = 4e-26 Identities = 62/73 (84%), Positives = 65/73 (89%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINF+PK DAVKQEVDRNEDMIRSA RAIASLNRISGGDCS KFKNLM EI+KS Sbjct: 1146 VDPLQKTINFKPKPDAVKQEVDRNEDMIRSALRAIASLNRISGGDCSAKFKNLMNEISKS 1205 Query: 379 STLSEKYSSIRNE 341 TL +KY SIRNE Sbjct: 1206 QTLWDKYYSIRNE 1218 >ref|XP_006385092.1| TIP120 family protein [Populus trichocarpa] gi|550341860|gb|ERP62889.1| TIP120 family protein [Populus trichocarpa] Length = 1223 Score = 122 bits (306), Expect = 6e-26 Identities = 62/73 (84%), Positives = 66/73 (90%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINF+PKQ AVKQEVDRNEDMIRSA RAIASLNRISGGDCS KFKNLM+EI+KS Sbjct: 1151 VDPLQKTINFKPKQVAVKQEVDRNEDMIRSALRAIASLNRISGGDCSLKFKNLMSEISKS 1210 Query: 379 STLSEKYSSIRNE 341 TL +KY SIRNE Sbjct: 1211 PTLWDKYYSIRNE 1223 >ref|XP_006349276.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Solanum tuberosum] Length = 1218 Score = 120 bits (300), Expect = 3e-25 Identities = 61/73 (83%), Positives = 65/73 (89%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINFRPKQDAVKQEVDRNEDMIRSA RAIA+LNRISGGD S+K KNLM EI K+ Sbjct: 1146 VDPLQKTINFRPKQDAVKQEVDRNEDMIRSALRAIAALNRISGGDYSHKLKNLMGEIGKA 1205 Query: 379 STLSEKYSSIRNE 341 STL +KY SIRNE Sbjct: 1206 STLWDKYCSIRNE 1218 >ref|XP_002303150.2| TIP120 family protein [Populus trichocarpa] gi|550342070|gb|EEE78129.2| TIP120 family protein [Populus trichocarpa] Length = 1215 Score = 119 bits (299), Expect = 4e-25 Identities = 59/73 (80%), Positives = 65/73 (89%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 V+PL KT+NF+PK DAVKQEVDRNEDMIRSA RAIASLNR SGGDCS KFKNLM+EI+KS Sbjct: 1143 VEPLQKTVNFKPKLDAVKQEVDRNEDMIRSALRAIASLNRTSGGDCSLKFKNLMSEISKS 1202 Query: 379 STLSEKYSSIRNE 341 TL +KY SIRNE Sbjct: 1203 QTLWDKYYSIRNE 1215 >gb|EXC26457.1| hypothetical protein L484_001858 [Morus notabilis] Length = 1243 Score = 119 bits (298), Expect = 5e-25 Identities = 61/73 (83%), Positives = 64/73 (87%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINF+PK DAVKQEVDRNEDMIRSA RAIASLNRISGGDCS KFKNLM EI+KS Sbjct: 1171 VDPLLKTINFKPKPDAVKQEVDRNEDMIRSALRAIASLNRISGGDCSLKFKNLMHEISKS 1230 Query: 379 STLSEKYSSIRNE 341 L +KY SIRNE Sbjct: 1231 PALWDKYYSIRNE 1243 >ref|XP_006431436.1| hypothetical protein CICLE_v10000063mg [Citrus clementina] gi|567877757|ref|XP_006431437.1| hypothetical protein CICLE_v10000063mg [Citrus clementina] gi|568833289|ref|XP_006470834.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like isoform X1 [Citrus sinensis] gi|568833291|ref|XP_006470835.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like isoform X2 [Citrus sinensis] gi|557533558|gb|ESR44676.1| hypothetical protein CICLE_v10000063mg [Citrus clementina] gi|557533559|gb|ESR44677.1| hypothetical protein CICLE_v10000063mg [Citrus clementina] Length = 1218 Score = 118 bits (296), Expect = 9e-25 Identities = 59/73 (80%), Positives = 66/73 (90%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINF+PKQDAVKQEVDRNEDMIRSA RAIASLN+ISGGDCS KFK+LM+EI+KS Sbjct: 1146 VDPLQKTINFKPKQDAVKQEVDRNEDMIRSALRAIASLNQISGGDCSMKFKSLMSEISKS 1205 Query: 379 STLSEKYSSIRNE 341 L EK+ +IRNE Sbjct: 1206 PMLWEKFYTIRNE 1218 >ref|XP_004307881.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Fragaria vesca subsp. vesca] Length = 1217 Score = 115 bits (289), Expect = 6e-24 Identities = 59/73 (80%), Positives = 62/73 (84%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VD L KTINF+PKQDAVKQEVDRNEDMIRSA R IASL+RISGGDCS KFKNL EIAKS Sbjct: 1145 VDHLQKTINFKPKQDAVKQEVDRNEDMIRSALRTIASLHRISGGDCSIKFKNLTNEIAKS 1204 Query: 379 STLSEKYSSIRNE 341 L +KY SIRNE Sbjct: 1205 PALWDKYCSIRNE 1217 >ref|XP_004230412.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Solanum lycopersicum] Length = 1217 Score = 112 bits (279), Expect = 8e-23 Identities = 59/73 (80%), Positives = 63/73 (86%) Frame = -3 Query: 559 VDPLHKTINFRPKQDAVKQEVDRNEDMIRSAFRAIASLNRISGGDCSYKFKNLMTEIAKS 380 VDPL KTINFRPKQDAVKQEVDRNEDMIRSA RAIA+LNRISGGD S+K KNLM EI K+ Sbjct: 1146 VDPLQKTINFRPKQDAVKQEVDRNEDMIRSALRAIAALNRISGGDYSHKLKNLMVEIEKT 1205 Query: 379 STLSEKYSSIRNE 341 S L +KY IRNE Sbjct: 1206 S-LWDKYCCIRNE 1217