BLASTX nr result
ID: Mentha24_contig00007760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00007760 (745 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004230951.1| PREDICTED: protein winged eye-like [Solanum ... 113 8e-23 ref|XP_003603985.1| Ebs-bah-phd domain-containing protein [Medic... 110 4e-22 ref|NP_001236094.1| uncharacterized protein LOC100526926 [Glycin... 110 5e-22 ref|XP_007135939.1| hypothetical protein PHAVU_009G004500g [Phas... 109 1e-21 ref|XP_003527148.1| PREDICTED: BAH and coiled-coil domain-contai... 108 2e-21 emb|CBI38025.3| unnamed protein product [Vitis vinifera] 108 3e-21 ref|XP_002263493.1| PREDICTED: chromatin structure-remodeling co... 108 3e-21 ref|XP_007042081.1| PHD finger family protein / bromo-adjacent d... 107 3e-21 ref|XP_004500782.1| PREDICTED: protein polybromo-1-like [Cicer a... 107 6e-21 ref|XP_002512960.1| phd finger transcription factor, putative [R... 107 6e-21 ref|XP_007200462.1| hypothetical protein PRUPE_ppa011301mg [Prun... 105 2e-20 ref|XP_006362024.1| PREDICTED: protein winged eye-like [Solanum ... 104 3e-20 gb|EYU42596.1| hypothetical protein MIMGU_mgv1a013749mg [Mimulus... 104 4e-20 ref|XP_006423394.1| hypothetical protein CICLE_v10029260mg [Citr... 103 8e-20 ref|XP_002305450.1| SHORT LIFE family protein [Populus trichocar... 102 1e-19 ref|XP_007042082.1| PHD finger family protein / bromo-adjacent d... 101 2e-19 ref|XP_004289655.1| PREDICTED: BAH and coiled-coil domain-contai... 101 2e-19 gb|EYU37830.1| hypothetical protein MIMGU_mgv1a013467mg [Mimulus... 101 3e-19 ref|XP_004148528.1| PREDICTED: BAH and coiled-coil domain-contai... 100 7e-19 ref|XP_007200463.1| hypothetical protein PRUPE_ppa011301mg [Prun... 99 2e-18 >ref|XP_004230951.1| PREDICTED: protein winged eye-like [Solanum lycopersicum] Length = 216 Score = 113 bits (282), Expect = 8e-23 Identities = 47/62 (75%), Positives = 57/62 (91%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCEGCSDWFHPTCIDMT EEA+R+DHF+C NCS+EDQKKL +SH ++R AD+KV+ Sbjct: 151 DDLMVQCEGCSDWFHPTCIDMTPEEAKRLDHFFCQNCSSEDQKKLLNSHATSRHADIKVE 210 Query: 181 TK 186 +K Sbjct: 211 SK 212 >ref|XP_003603985.1| Ebs-bah-phd domain-containing protein [Medicago truncatula] gi|355493033|gb|AES74236.1| Ebs-bah-phd domain-containing protein [Medicago truncatula] gi|388498190|gb|AFK37161.1| unknown [Medicago truncatula] Length = 218 Score = 110 bits (276), Expect = 4e-22 Identities = 47/62 (75%), Positives = 54/62 (87%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCEGCSDWFHP CIDMTVEEA+R+DHF+C +CS E QK+L +SH +TR AD KVD Sbjct: 153 DDLMVQCEGCSDWFHPACIDMTVEEAERLDHFFCESCSVEGQKQLQNSHSATRLADTKVD 212 Query: 181 TK 186 TK Sbjct: 213 TK 214 >ref|NP_001236094.1| uncharacterized protein LOC100526926 [Glycine max] gi|255631163|gb|ACU15947.1| unknown [Glycine max] Length = 216 Score = 110 bits (275), Expect = 5e-22 Identities = 46/62 (74%), Positives = 54/62 (87%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCEGC+DWFHP CIDMTVEEA+R+DHF+C NCS E QKKL +SH ++R +D KVD Sbjct: 151 DDLMVQCEGCTDWFHPACIDMTVEEAKRLDHFFCENCSAEGQKKLQNSHSASRHSDTKVD 210 Query: 181 TK 186 TK Sbjct: 211 TK 212 >ref|XP_007135939.1| hypothetical protein PHAVU_009G004500g [Phaseolus vulgaris] gi|561009026|gb|ESW07933.1| hypothetical protein PHAVU_009G004500g [Phaseolus vulgaris] Length = 216 Score = 109 bits (272), Expect = 1e-21 Identities = 46/62 (74%), Positives = 54/62 (87%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCEGCSDWFHP CIDMTVEEA+R+DHF+C +CS E QKKL +SH ++R +D KVD Sbjct: 151 DDLMVQCEGCSDWFHPACIDMTVEEAKRLDHFFCESCSAEGQKKLQNSHSASRLSDTKVD 210 Query: 181 TK 186 TK Sbjct: 211 TK 212 >ref|XP_003527148.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like isoform X1 [Glycine max] Length = 216 Score = 108 bits (270), Expect = 2e-21 Identities = 45/62 (72%), Positives = 54/62 (87%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCEGC+DWFHP CIDMTVEEA+R+DHF+C +CS E QKKL +SH ++R +D KVD Sbjct: 151 DDLMVQCEGCTDWFHPACIDMTVEEAKRLDHFFCESCSAEGQKKLQNSHSASRHSDTKVD 210 Query: 181 TK 186 TK Sbjct: 211 TK 212 >emb|CBI38025.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 108 bits (269), Expect = 3e-21 Identities = 45/62 (72%), Positives = 55/62 (88%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCEGC+DWFHP CIDMT EEA+R++HF+C NCS+EDQKKL +SH ++R +D KVD Sbjct: 150 DDLMVQCEGCTDWFHPACIDMTPEEAKRLEHFFCQNCSSEDQKKLLNSHNASRHSDAKVD 209 Query: 181 TK 186 TK Sbjct: 210 TK 211 >ref|XP_002263493.1| PREDICTED: chromatin structure-remodeling complex subunit RSC1-like [Vitis vinifera] Length = 224 Score = 108 bits (269), Expect = 3e-21 Identities = 45/62 (72%), Positives = 55/62 (88%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCEGC+DWFHP CIDMT EEA+R++HF+C NCS+EDQKKL +SH ++R +D KVD Sbjct: 159 DDLMVQCEGCTDWFHPACIDMTPEEAKRLEHFFCQNCSSEDQKKLLNSHNASRHSDAKVD 218 Query: 181 TK 186 TK Sbjct: 219 TK 220 >ref|XP_007042081.1| PHD finger family protein / bromo-adjacent domain-containing protein isoform 1 [Theobroma cacao] gi|508706016|gb|EOX97912.1| PHD finger family protein / bromo-adjacent domain-containing protein isoform 1 [Theobroma cacao] Length = 216 Score = 107 bits (268), Expect = 3e-21 Identities = 44/62 (70%), Positives = 54/62 (87%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCEGCSDWFHP CI+MT EEA+R+DHF+C +CS+E QKKL +SH ++R +D KVD Sbjct: 151 DDLMVQCEGCSDWFHPACIEMTAEEAKRLDHFFCESCSSEGQKKLQNSHATSRHSDTKVD 210 Query: 181 TK 186 TK Sbjct: 211 TK 212 >ref|XP_004500782.1| PREDICTED: protein polybromo-1-like [Cicer arietinum] Length = 218 Score = 107 bits (266), Expect = 6e-21 Identities = 45/62 (72%), Positives = 52/62 (83%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 D+LMVQCEGCSDWFHP CIDMTVEEA+R+DHF+C +CS E QKKL +SH + R D KVD Sbjct: 153 DELMVQCEGCSDWFHPACIDMTVEEAKRLDHFFCESCSVEGQKKLQNSHSAARHLDTKVD 212 Query: 181 TK 186 TK Sbjct: 213 TK 214 >ref|XP_002512960.1| phd finger transcription factor, putative [Ricinus communis] gi|223547971|gb|EEF49463.1| phd finger transcription factor, putative [Ricinus communis] Length = 216 Score = 107 bits (266), Expect = 6e-21 Identities = 43/62 (69%), Positives = 54/62 (87%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCEGC+DWFHPTCI+MT EEA+R+DHF+C NCS+E QKKL +SH ++R + KV+ Sbjct: 151 DDLMVQCEGCTDWFHPTCIEMTAEEAKRLDHFFCENCSSEGQKKLQNSHTTSRQPETKVE 210 Query: 181 TK 186 TK Sbjct: 211 TK 212 >ref|XP_007200462.1| hypothetical protein PRUPE_ppa011301mg [Prunus persica] gi|462395862|gb|EMJ01661.1| hypothetical protein PRUPE_ppa011301mg [Prunus persica] Length = 216 Score = 105 bits (261), Expect = 2e-20 Identities = 43/62 (69%), Positives = 51/62 (82%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCEGCSDWFHP CIDM EEA+R+DHF+C CS+E QKKL +SH +++ D KVD Sbjct: 151 DDLMVQCEGCSDWFHPACIDMNAEEAKRLDHFFCEGCSSEGQKKLQNSHTASKHPDTKVD 210 Query: 181 TK 186 TK Sbjct: 211 TK 212 >ref|XP_006362024.1| PREDICTED: protein winged eye-like [Solanum tuberosum] Length = 211 Score = 104 bits (260), Expect = 3e-20 Identities = 46/62 (74%), Positives = 54/62 (87%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCEGCSDWFHPTCIDMT EEA+R+DHF+C NCS+EDQKKL +SH AD+KV+ Sbjct: 151 DDLMVQCEGCSDWFHPTCIDMTPEEAKRLDHFFCQNCSSEDQKKLLNSH-----ADIKVE 205 Query: 181 TK 186 +K Sbjct: 206 SK 207 >gb|EYU42596.1| hypothetical protein MIMGU_mgv1a013749mg [Mimulus guttatus] Length = 211 Score = 104 bits (259), Expect = 4e-20 Identities = 46/62 (74%), Positives = 53/62 (85%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCE CSDWFHPTCIDMT EEA++++HFYC+NCSTEDQKKL SH AD+KV+ Sbjct: 151 DDLMVQCEECSDWFHPTCIDMTPEEARKVEHFYCYNCSTEDQKKLPTSH-----ADMKVE 205 Query: 181 TK 186 TK Sbjct: 206 TK 207 >ref|XP_006423394.1| hypothetical protein CICLE_v10029260mg [Citrus clementina] gi|568868071|ref|XP_006487342.1| PREDICTED: chromatin structure-remodeling complex subunit RSC1-like [Citrus sinensis] gi|557525328|gb|ESR36634.1| hypothetical protein CICLE_v10029260mg [Citrus clementina] Length = 216 Score = 103 bits (256), Expect = 8e-20 Identities = 43/62 (69%), Positives = 52/62 (83%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCEGCSDWFHP CI+MT EEA+R+DHF+C +CSTE QKKL +S + R +D KV+ Sbjct: 151 DDLMVQCEGCSDWFHPNCINMTAEEAKRLDHFFCESCSTEGQKKLQNSQANGRHSDAKVE 210 Query: 181 TK 186 TK Sbjct: 211 TK 212 >ref|XP_002305450.1| SHORT LIFE family protein [Populus trichocarpa] gi|222848414|gb|EEE85961.1| SHORT LIFE family protein [Populus trichocarpa] Length = 215 Score = 102 bits (254), Expect = 1e-19 Identities = 43/62 (69%), Positives = 53/62 (85%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCEGCSDWFHP CI+M+ EEA+R+DHF+C NCS+E QKKL +SH +TR +D K + Sbjct: 151 DDLMVQCEGCSDWFHPACIEMSAEEAKRLDHFFCENCSSEGQKKLQNSH-NTRQSDAKAE 209 Query: 181 TK 186 TK Sbjct: 210 TK 211 >ref|XP_007042082.1| PHD finger family protein / bromo-adjacent domain-containing protein isoform 2 [Theobroma cacao] gi|508706017|gb|EOX97913.1| PHD finger family protein / bromo-adjacent domain-containing protein isoform 2 [Theobroma cacao] Length = 249 Score = 101 bits (252), Expect = 2e-19 Identities = 41/59 (69%), Positives = 51/59 (86%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKV 177 DDLMVQCEGCSDWFHP CI+MT EEA+R+DHF+C +CS+E QKKL +SH ++R +D KV Sbjct: 151 DDLMVQCEGCSDWFHPACIEMTAEEAKRLDHFFCESCSSEGQKKLQNSHATSRHSDTKV 209 >ref|XP_004289655.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Fragaria vesca subsp. vesca] Length = 216 Score = 101 bits (252), Expect = 2e-19 Identities = 41/62 (66%), Positives = 51/62 (82%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCEGC+DWFHP CIDM+ EEA+R++HF+C +CS E QKKL +SH +R D KV+ Sbjct: 151 DDLMVQCEGCNDWFHPACIDMSAEEAERLEHFFCESCSPEGQKKLENSHTVSRQLDTKVE 210 Query: 181 TK 186 TK Sbjct: 211 TK 212 >gb|EYU37830.1| hypothetical protein MIMGU_mgv1a013467mg [Mimulus guttatus] Length = 219 Score = 101 bits (251), Expect = 3e-19 Identities = 43/62 (69%), Positives = 54/62 (87%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 D+LMVQCEGC++WFHPTCI+MT EEA+++D FYC +CS+EDQ KL +SHVST +D KVD Sbjct: 154 DELMVQCEGCTEWFHPTCIEMTPEEAKKLDCFYCLSCSSEDQNKLQNSHVSTGHSDEKVD 213 Query: 181 TK 186 TK Sbjct: 214 TK 215 >ref|XP_004148528.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] gi|449516389|ref|XP_004165229.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] Length = 216 Score = 100 bits (248), Expect = 7e-19 Identities = 41/62 (66%), Positives = 52/62 (83%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKVD 180 DDLMVQCE CSDWFHP CI+MT EEA+++DHFYC +CS+E QKKL +S +++ A+ KVD Sbjct: 151 DDLMVQCENCSDWFHPACIEMTTEEAKKLDHFYCESCSSEGQKKLQNSQSTSKVAETKVD 210 Query: 181 TK 186 TK Sbjct: 211 TK 212 >ref|XP_007200463.1| hypothetical protein PRUPE_ppa011301mg [Prunus persica] gi|462395863|gb|EMJ01662.1| hypothetical protein PRUPE_ppa011301mg [Prunus persica] Length = 216 Score = 99.0 bits (245), Expect = 2e-18 Identities = 40/59 (67%), Positives = 48/59 (81%) Frame = +1 Query: 1 DDLMVQCEGCSDWFHPTCIDMTVEEAQRIDHFYCHNCSTEDQKKLHDSHVSTRSADLKV 177 DDLMVQCEGCSDWFHP CIDM EEA+R+DHF+C CS+E QKKL +SH +++ D KV Sbjct: 151 DDLMVQCEGCSDWFHPACIDMNAEEAKRLDHFFCEGCSSEGQKKLQNSHTASKHPDTKV 209