BLASTX nr result
ID: Mentha24_contig00007715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00007715 (498 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33431.1| hypothetical protein MIMGU_mgv1a019605mg, partial... 66 4e-09 >gb|EYU33431.1| hypothetical protein MIMGU_mgv1a019605mg, partial [Mimulus guttatus] Length = 244 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/52 (57%), Positives = 46/52 (88%), Gaps = 1/52 (1%) Frame = +1 Query: 1 VPRNHILNKKASPVIWEIPCGNKEHAAAVSAVTFGFAI-ATALLIVSSISHS 153 +P N+IL+++ASPV+WEIPCG K+HA VSAVTFGFA+ A+++++++SI +S Sbjct: 182 MPDNNILDREASPVMWEIPCGIKKHAEFVSAVTFGFAVLASSIIVLTSIFYS 233