BLASTX nr result
ID: Mentha24_contig00007500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00007500 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20818.1| hypothetical protein MIMGU_mgv1a008714mg [Mimulus... 59 5e-07 >gb|EYU20818.1| hypothetical protein MIMGU_mgv1a008714mg [Mimulus guttatus] Length = 364 Score = 59.3 bits (142), Expect = 5e-07 Identities = 37/62 (59%), Positives = 39/62 (62%), Gaps = 9/62 (14%) Frame = +1 Query: 154 MDLTSRLAAESDGNGVVSERKAVEEQQ---------PTYVSLVDPFLVEALQNPRHRLTI 306 MDLTS+ A ES G RKA E+ P YVS VDPFLVEALQNPRHRLTI Sbjct: 1 MDLTSQSAVES---GAFLGRKAAAEEVVEDAAVEPLPFYVSAVDPFLVEALQNPRHRLTI 57 Query: 307 LR 312 LR Sbjct: 58 LR 59