BLASTX nr result
ID: Mentha24_contig00007347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00007347 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007206183.1| hypothetical protein PRUPE_ppa013857mg [Prun... 111 1e-22 gb|EYU19377.1| hypothetical protein MIMGU_mgv1a0175922mg [Mimulu... 107 1e-21 gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza] 107 2e-21 gb|AAF26091.1|AC012393_17 low temperature and salt responsive pr... 103 3e-20 gb|EXB57550.1| Hydrophobic protein LTI6A [Morus notabilis] 102 6e-20 ref|XP_003626131.1| Hydrophobic protein RCI2B [Medicago truncatu... 102 6e-20 ref|XP_004302327.1| PREDICTED: hydrophobic protein RCI2A-like [F... 102 7e-20 ref|XP_002884539.1| low temperature and salt responsive protein ... 101 1e-19 ref|XP_006408016.1| hypothetical protein EUTSA_v10021895mg [Eutr... 100 2e-19 ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana... 100 3e-19 ref|XP_006298933.1| hypothetical protein CARUB_v10015055mg [Caps... 100 3e-19 gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6... 100 3e-19 ref|XP_003626135.1| Hydrophobic protein LTI6B [Medicago truncatu... 100 4e-19 gb|ABD33207.2| Protein of unknown function UPF0057 [Medicago tru... 100 4e-19 gb|AAQ84111.1| Clt1 [Citrus trifoliata] 100 4e-19 ref|XP_006408015.1| hypothetical protein EUTSA_v10021802mg [Eutr... 99 5e-19 ref|XP_007207409.1| hypothetical protein PRUPE_ppa014548mg [Prun... 99 5e-19 gb|ABK25741.1| unknown [Picea sitchensis] 98 1e-18 ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citr... 98 1e-18 ref|NP_187239.1| Hydrophobic protein RCI2A [Arabidopsis thaliana... 98 1e-18 >ref|XP_007206183.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica] gi|462401825|gb|EMJ07382.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica] Length = 93 Score = 111 bits (277), Expect = 1e-22 Identities = 49/59 (83%), Positives = 56/59 (94%) Frame = -2 Query: 303 EREVEMGSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 + + MG+ATF+DII+AILLPPLGVFLKFGCEAEFWICL+LTLFGYLPGIIYAIYI+TK Sbjct: 35 QNSIRMGTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILTLFGYLPGIIYAIYILTK 93 >gb|EYU19377.1| hypothetical protein MIMGU_mgv1a0175922mg [Mimulus guttatus] Length = 54 Score = 107 bits (268), Expect = 1e-21 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = -2 Query: 288 MGSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 MGSATF+DIIVAILLPPLGVFLKFGCE EFWICL+LTLFGYLPGIIYAIY ITK Sbjct: 1 MGSATFVDIIVAILLPPLGVFLKFGCEVEFWICLVLTLFGYLPGIIYAIYAITK 54 >gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza] Length = 54 Score = 107 bits (266), Expect = 2e-21 Identities = 49/54 (90%), Positives = 53/54 (98%) Frame = -2 Query: 288 MGSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 MG+ATFIDII+AILLPPLGVFLKFGC AEFWICL+LTLFGY+PGIIYAIYIITK Sbjct: 1 MGTATFIDIIIAILLPPLGVFLKFGCGAEFWICLILTLFGYIPGIIYAIYIITK 54 >gb|AAF26091.1|AC012393_17 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] Length = 67 Score = 103 bits (257), Expect = 3e-20 Identities = 46/61 (75%), Positives = 56/61 (91%) Frame = -2 Query: 288 MGSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK*GSFFM 109 M +ATF++II+AI+LPPLGVFLKFGC+ EFWICL+LTLFGYLPGI+YA+YIITK S F+ Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITKKNSCFV 60 Query: 108 V 106 V Sbjct: 61 V 61 >gb|EXB57550.1| Hydrophobic protein LTI6A [Morus notabilis] Length = 57 Score = 102 bits (254), Expect = 6e-20 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = -2 Query: 285 GSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 GSAT +DI++AI+LPPLGVFLKFGC AEFWICLLLTLFGYLPGIIYA+YIITK Sbjct: 5 GSATCVDILLAIILPPLGVFLKFGCRAEFWICLLLTLFGYLPGIIYAVYIITK 57 >ref|XP_003626131.1| Hydrophobic protein RCI2B [Medicago truncatula] gi|87241331|gb|ABD33189.1| Protein of unknown function UPF0057; Bacterial extracellular solute-binding protein, family 3 [Medicago truncatula] gi|355501146|gb|AES82349.1| Hydrophobic protein RCI2B [Medicago truncatula] Length = 54 Score = 102 bits (254), Expect = 6e-20 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = -2 Query: 288 MGSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 MG+ATF+DII++ILLPPLGVFLKFG E EFWICL+LTLFGYLPGIIYAIYIITK Sbjct: 1 MGTATFVDIILSILLPPLGVFLKFGLEVEFWICLVLTLFGYLPGIIYAIYIITK 54 >ref|XP_004302327.1| PREDICTED: hydrophobic protein RCI2A-like [Fragaria vesca subsp. vesca] Length = 57 Score = 102 bits (253), Expect = 7e-20 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -2 Query: 285 GSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 G+A FIDII+AILLPPLGVFLKFGC EFWICLLLT+FGY+PGIIYAIY+ITK Sbjct: 5 GTANFIDIIIAILLPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAIYVITK 57 >ref|XP_002884539.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] gi|297330379|gb|EFH60798.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] Length = 67 Score = 101 bits (252), Expect = 1e-19 Identities = 45/61 (73%), Positives = 55/61 (90%) Frame = -2 Query: 288 MGSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK*GSFFM 109 M +ATF++II+AI+LPPLGVFLKFGC+ EFWICL+LTLFGYLPGI+YA+YIITK F+ Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITKRNRCFV 60 Query: 108 V 106 V Sbjct: 61 V 61 >ref|XP_006408016.1| hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] gi|557109162|gb|ESQ49469.1| hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] Length = 54 Score = 100 bits (249), Expect = 2e-19 Identities = 43/54 (79%), Positives = 52/54 (96%) Frame = -2 Query: 288 MGSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 MG+ATFIDI++AILLPPLGVFL+FGC EFWICL+LTLFGYLPGI+YA+Y++TK Sbjct: 1 MGTATFIDILLAILLPPLGVFLRFGCGVEFWICLVLTLFGYLPGILYALYVLTK 54 >ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] gi|15214252|sp|Q9ZNS6.1|RCI2B_ARATH RecName: Full=Hydrophobic protein RCI2B; AltName: Full=Low temperature and salt-responsive protein LTI6B gi|6671968|gb|AAF23227.1|AC013454_14 low temperature and salt responsive protein (LTI6B) [Arabidopsis thaliana] gi|13957673|gb|AAK50618.1|AF264749_1 hydrophobic protein RCI2B [Arabidopsis thaliana] gi|4039152|gb|AAC97511.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|4325219|gb|AAD17303.1| hydrophobic protein [Arabidopsis thaliana] gi|21536934|gb|AAM61275.1| hydrophobic protein RCI2B (Low temperature and salt responsive protein LTI6B) [Arabidopsis thaliana] gi|51970648|dbj|BAD44016.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|109134195|gb|ABG25095.1| At3g05890 [Arabidopsis thaliana] gi|110737346|dbj|BAF00618.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|332640791|gb|AEE74312.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] Length = 54 Score = 100 bits (248), Expect = 3e-19 Identities = 43/54 (79%), Positives = 52/54 (96%) Frame = -2 Query: 288 MGSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 M +ATF++II+AI+LPPLGVFLKFGC+ EFWICL+LTLFGYLPGI+YA+YIITK Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >ref|XP_006298933.1| hypothetical protein CARUB_v10015055mg [Capsella rubella] gi|482567642|gb|EOA31831.1| hypothetical protein CARUB_v10015055mg [Capsella rubella] Length = 54 Score = 100 bits (248), Expect = 3e-19 Identities = 43/54 (79%), Positives = 52/54 (96%) Frame = -2 Query: 288 MGSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 M +ATF++I++AILLPPLGVFLKFGC+ EFWICL+LTLFGYLPGI+YA+YIITK Sbjct: 1 MSTATFVEILLAILLPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6-LTI6b] Length = 726 Score = 100 bits (248), Expect = 3e-19 Identities = 43/54 (79%), Positives = 52/54 (96%) Frame = -2 Query: 288 MGSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 M +ATF++II+AI+LPPLGVFLKFGC+ EFWICL+LTLFGYLPGI+YA+YIITK Sbjct: 673 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 726 >ref|XP_003626135.1| Hydrophobic protein LTI6B [Medicago truncatula] gi|355501150|gb|AES82353.1| Hydrophobic protein LTI6B [Medicago truncatula] Length = 83 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 288 MGSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 MG+AT IDIIVAI+LPPLGVFLKFGC EFW+CL+LTLFGYLPGI+YAIY ITK Sbjct: 1 MGTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLFGYLPGILYAIYAITK 54 >gb|ABD33207.2| Protein of unknown function UPF0057 [Medicago truncatula] Length = 54 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 288 MGSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 MG+AT IDIIVAI+LPPLGVFLKFGC EFW+CL+LTLFGYLPGI+YAIY ITK Sbjct: 1 MGTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLFGYLPGILYAIYAITK 54 >gb|AAQ84111.1| Clt1 [Citrus trifoliata] Length = 54 Score = 99.8 bits (247), Expect = 4e-19 Identities = 42/54 (77%), Positives = 52/54 (96%) Frame = -2 Query: 288 MGSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 MG+AT +DII+A++LPPLGVFLKFGC+AEFWICLLLT+ GY+PGIIYA+Y+ITK Sbjct: 1 MGTATCVDIILAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYVITK 54 >ref|XP_006408015.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] gi|557109161|gb|ESQ49468.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] Length = 111 Score = 99.4 bits (246), Expect = 5e-19 Identities = 43/56 (76%), Positives = 53/56 (94%) Frame = -2 Query: 294 VEMGSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 ++MG+ATF++II+AI+LPPLGVFLKFGC+ EFWICL+LTL GYLPGIIYA+Y ITK Sbjct: 55 LKMGTATFVEIILAIILPPLGVFLKFGCKIEFWICLILTLLGYLPGIIYALYAITK 110 >ref|XP_007207409.1| hypothetical protein PRUPE_ppa014548mg [Prunus persica] gi|462403051|gb|EMJ08608.1| hypothetical protein PRUPE_ppa014548mg [Prunus persica] Length = 57 Score = 99.4 bits (246), Expect = 5e-19 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -2 Query: 285 GSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 G+A FIDI++AILLPPLGVFLKFGC EFWICLLLT+FGY+PGIIYA+Y ITK Sbjct: 5 GTANFIDILIAILLPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAVYAITK 57 >gb|ABK25741.1| unknown [Picea sitchensis] Length = 58 Score = 98.2 bits (243), Expect = 1e-18 Identities = 43/53 (81%), Positives = 51/53 (96%) Frame = -2 Query: 285 GSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 G+ATFIDI++AILLPPLGVFLK+ C AEFWICLLLTLFGYLPGIIYA+Y++T+ Sbjct: 4 GTATFIDILLAILLPPLGVFLKYECHAEFWICLLLTLFGYLPGIIYALYVLTQ 56 >ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|567871515|ref|XP_006428347.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|568853386|ref|XP_006480340.1| PREDICTED: hydrophobic protein LTI6A-like [Citrus sinensis] gi|557530403|gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|557530404|gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] Length = 58 Score = 97.8 bits (242), Expect = 1e-18 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -2 Query: 285 GSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 G+AT IDII+AI+LPPLGVFLKFGC+ EFWICLLLT+FGY+PGIIYA+Y ITK Sbjct: 5 GTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 57 >ref|NP_187239.1| Hydrophobic protein RCI2A [Arabidopsis thaliana] gi|15214251|sp|Q9ZNQ7.1|RCI2A_ARATH RecName: Full=Hydrophobic protein RCI2A; AltName: Full=Low temperature and salt-responsive protein LTI6A gi|6714401|gb|AAF26090.1|AC012393_16 low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] gi|13957674|gb|AAK50619.1|AF264749_2 hydrophobic protein RCI2A [Arabidopsis thaliana] gi|4039153|gb|AAC97512.1| low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] gi|4325217|gb|AAD17302.1| hydrophobic protein [Arabidopsis thaliana] gi|14335130|gb|AAK59845.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|14532470|gb|AAK63963.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|18655345|gb|AAL76128.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|332640790|gb|AEE74311.1| Hydrophobic protein RCI2A [Arabidopsis thaliana] Length = 54 Score = 97.8 bits (242), Expect = 1e-18 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = -2 Query: 288 MGSATFIDIIVAILLPPLGVFLKFGCEAEFWICLLLTLFGYLPGIIYAIYIITK 127 M +ATF+DII+AILLPPLGVFL+FGC EFWICL+LTL GY+PGIIYAIY++TK Sbjct: 1 MSTATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54