BLASTX nr result
ID: Mentha24_contig00007221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00007221 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM34765.1|AF509865_1 nam-like protein 2 [Petunia x hybrida] 70 4e-10 ref|XP_004249904.1| PREDICTED: uncharacterized protein LOC101248... 67 2e-09 gb|EYU23774.1| hypothetical protein MIMGU_mgv1a007138mg [Mimulus... 66 6e-09 gb|EYU23773.1| hypothetical protein MIMGU_mgv1a007138mg [Mimulus... 66 6e-09 ref|XP_006351034.1| PREDICTED: uncharacterized protein LOC102602... 66 6e-09 ref|XP_006355149.1| PREDICTED: NAC domain-containing protein 78-... 65 1e-08 ref|XP_006355148.1| PREDICTED: NAC domain-containing protein 78-... 65 1e-08 ref|XP_006355147.1| PREDICTED: NAC domain-containing protein 78-... 65 1e-08 ref|XP_006382846.1| hypothetical protein POPTR_0005s06040g [Popu... 65 1e-08 ref|XP_002310505.1| hypothetical protein POPTR_0007s03840g [Popu... 63 4e-08 gb|EPS72463.1| nam-like protein 2 [Genlisea aurea] 63 5e-08 gb|AGL39698.1| NAC transcription factor 042 [Jatropha curcas] 63 5e-08 gb|EMT22201.1| NAC domain-containing protein 78 [Aegilops tauschii] 62 6e-08 gb|EMS46324.1| NAC domain-containing protein 78 [Triticum urartu] 62 6e-08 gb|EXB40984.1| NAC domain-containing protein 78 [Morus notabilis] 62 8e-08 dbj|BAK01976.1| predicted protein [Hordeum vulgare subsp. vulgare] 61 1e-07 dbj|BAG32519.1| transcription factor [Hordeum vulgare subsp. vul... 61 1e-07 ref|XP_006432239.1| hypothetical protein CICLE_v10001200mg [Citr... 61 2e-07 ref|XP_006432238.1| hypothetical protein CICLE_v10001200mg [Citr... 61 2e-07 ref|XP_004290501.1| PREDICTED: uncharacterized protein LOC101314... 60 3e-07 >gb|AAM34765.1|AF509865_1 nam-like protein 2 [Petunia x hybrida] Length = 487 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +3 Query: 213 RLPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 RLPPGFRFHPTDVEL++YYLKRKIMGKKLH++A Sbjct: 3 RLPPGFRFHPTDVELVMYYLKRKIMGKKLHFDA 35 >ref|XP_004249904.1| PREDICTED: uncharacterized protein LOC101248635 [Solanum lycopersicum] Length = 687 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 213 RLPPGFRFHPTDVELILYYLKRKIMGKKLHYE 308 RLPPGFRFHPTDVELI+YYLKRKI GKKLH+E Sbjct: 3 RLPPGFRFHPTDVELIMYYLKRKITGKKLHFE 34 >gb|EYU23774.1| hypothetical protein MIMGU_mgv1a007138mg [Mimulus guttatus] Length = 412 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 207 RMRLPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 R LPPGFRFHPTDVELI+YYLKRK+MGKKL +EA Sbjct: 3 RTSLPPGFRFHPTDVELIMYYLKRKVMGKKLLFEA 37 >gb|EYU23773.1| hypothetical protein MIMGU_mgv1a007138mg [Mimulus guttatus] Length = 418 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 207 RMRLPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 R LPPGFRFHPTDVELI+YYLKRK+MGKKL +EA Sbjct: 3 RTSLPPGFRFHPTDVELIMYYLKRKVMGKKLLFEA 37 >ref|XP_006351034.1| PREDICTED: uncharacterized protein LOC102602510 [Solanum tuberosum] Length = 783 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 213 RLPPGFRFHPTDVELILYYLKRKIMGKKLHYE 308 RLPPGFRFHPTDVELI+YYLKRKI GKK H+E Sbjct: 3 RLPPGFRFHPTDVELIMYYLKRKITGKKFHFE 34 >ref|XP_006355149.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Solanum tuberosum] Length = 467 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 213 RLPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 +LPPGFRFHPTDVELI+YYLKRKIMGKK+ +EA Sbjct: 3 KLPPGFRFHPTDVELIMYYLKRKIMGKKILFEA 35 >ref|XP_006355148.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Solanum tuberosum] Length = 471 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 213 RLPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 +LPPGFRFHPTDVELI+YYLKRKIMGKK+ +EA Sbjct: 3 KLPPGFRFHPTDVELIMYYLKRKIMGKKILFEA 35 >ref|XP_006355147.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Solanum tuberosum] Length = 525 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 213 RLPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 +LPPGFRFHPTDVELI+YYLKRKIMGKK+ +EA Sbjct: 3 KLPPGFRFHPTDVELIMYYLKRKIMGKKILFEA 35 >ref|XP_006382846.1| hypothetical protein POPTR_0005s06040g [Populus trichocarpa] gi|550338216|gb|ERP60643.1| hypothetical protein POPTR_0005s06040g [Populus trichocarpa] Length = 402 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 216 LPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 LPPGFRFHPTDVEL+ YYLKRK++GKKLH++A Sbjct: 7 LPPGFRFHPTDVELVKYYLKRKVLGKKLHFQA 38 >ref|XP_002310505.1| hypothetical protein POPTR_0007s03840g [Populus trichocarpa] gi|222853408|gb|EEE90955.1| hypothetical protein POPTR_0007s03840g [Populus trichocarpa] Length = 431 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 216 LPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 LPPGFRFHPTDVEL+ YYLKRK++GKK H++A Sbjct: 7 LPPGFRFHPTDVELVKYYLKRKVLGKKFHFQA 38 >gb|EPS72463.1| nam-like protein 2 [Genlisea aurea] Length = 352 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 216 LPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 +PPGFRFHPTD+ELI+YYLKRK+ G+K H+EA Sbjct: 6 IPPGFRFHPTDIELIMYYLKRKVTGRKFHFEA 37 >gb|AGL39698.1| NAC transcription factor 042 [Jatropha curcas] Length = 473 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 216 LPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 LPPGFRFHPTDVEL+ YYLKRK++GK LH++A Sbjct: 6 LPPGFRFHPTDVELVKYYLKRKVLGKNLHFDA 37 >gb|EMT22201.1| NAC domain-containing protein 78 [Aegilops tauschii] Length = 429 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 216 LPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 LPPGFRFHPTDVEL+ YYLKRKIMGKKL EA Sbjct: 6 LPPGFRFHPTDVELVSYYLKRKIMGKKLFVEA 37 >gb|EMS46324.1| NAC domain-containing protein 78 [Triticum urartu] Length = 411 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 216 LPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 LPPGFRFHPTDVEL+ YYLKRKIMGKKL EA Sbjct: 6 LPPGFRFHPTDVELVSYYLKRKIMGKKLFVEA 37 >gb|EXB40984.1| NAC domain-containing protein 78 [Morus notabilis] Length = 381 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 216 LPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 L PGFRFHPTDVEL+ YYLKRKI+G+KLH+EA Sbjct: 6 LSPGFRFHPTDVELVKYYLKRKILGRKLHFEA 37 >dbj|BAK01976.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 402 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 216 LPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 LPPG+RFHPTDVEL LYYLKRK++GKKLH A Sbjct: 6 LPPGYRFHPTDVELTLYYLKRKLLGKKLHCNA 37 >dbj|BAG32519.1| transcription factor [Hordeum vulgare subsp. vulgare] Length = 431 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 216 LPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 LPPGFRFHPTDVEL+ YYLKRKIMGKKL +A Sbjct: 6 LPPGFRFHPTDVELVSYYLKRKIMGKKLFVQA 37 >ref|XP_006432239.1| hypothetical protein CICLE_v10001200mg [Citrus clementina] gi|567879363|ref|XP_006432240.1| hypothetical protein CICLE_v10001200mg [Citrus clementina] gi|567879365|ref|XP_006432241.1| hypothetical protein CICLE_v10001200mg [Citrus clementina] gi|567879367|ref|XP_006432242.1| hypothetical protein CICLE_v10001200mg [Citrus clementina] gi|567879369|ref|XP_006432243.1| hypothetical protein CICLE_v10001200mg [Citrus clementina] gi|567879371|ref|XP_006432244.1| hypothetical protein CICLE_v10001200mg [Citrus clementina] gi|568820258|ref|XP_006464643.1| PREDICTED: NAC domain-containing protein 74-like isoform X1 [Citrus sinensis] gi|557534361|gb|ESR45479.1| hypothetical protein CICLE_v10001200mg [Citrus clementina] gi|557534362|gb|ESR45480.1| hypothetical protein CICLE_v10001200mg [Citrus clementina] gi|557534363|gb|ESR45481.1| hypothetical protein CICLE_v10001200mg [Citrus clementina] gi|557534364|gb|ESR45482.1| hypothetical protein CICLE_v10001200mg [Citrus clementina] gi|557534365|gb|ESR45483.1| hypothetical protein CICLE_v10001200mg [Citrus clementina] gi|557534366|gb|ESR45484.1| hypothetical protein CICLE_v10001200mg [Citrus clementina] Length = 434 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 216 LPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 LPPGFRFHPTDVELI YYLKRK+MG+K +EA Sbjct: 6 LPPGFRFHPTDVELIKYYLKRKVMGRKFGFEA 37 >ref|XP_006432238.1| hypothetical protein CICLE_v10001200mg [Citrus clementina] gi|557534360|gb|ESR45478.1| hypothetical protein CICLE_v10001200mg [Citrus clementina] Length = 433 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 216 LPPGFRFHPTDVELILYYLKRKIMGKKLHYEA 311 LPPGFRFHPTDVELI YYLKRK+MG+K +EA Sbjct: 6 LPPGFRFHPTDVELIKYYLKRKVMGRKFGFEA 37 >ref|XP_004290501.1| PREDICTED: uncharacterized protein LOC101314425 [Fragaria vesca subsp. vesca] Length = 401 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 216 LPPGFRFHPTDVELILYYLKRKIMGKKLH 302 LPPGFRF+PTDVEL+ YYLKRKIMGKKLH Sbjct: 6 LPPGFRFNPTDVELVQYYLKRKIMGKKLH 34