BLASTX nr result
ID: Mentha24_contig00007138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00007138 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19455.1| hypothetical protein MIMGU_mgv1a013552mg [Mimulus... 57 3e-06 >gb|EYU19455.1| hypothetical protein MIMGU_mgv1a013552mg [Mimulus guttatus] Length = 217 Score = 56.6 bits (135), Expect = 3e-06 Identities = 33/68 (48%), Positives = 42/68 (61%), Gaps = 5/68 (7%) Frame = +1 Query: 130 QTLFMLPKCSAHCQPRNLAFSAAIS-RRPLAGGLASRVLMRPSGFNF----KNLSFSVRA 294 Q LFM+P+ + C+ NLAFSAA+S RRP GGL SRV GF+ KN SF V+A Sbjct: 8 QALFMVPRSTFECRSNNLAFSAAVSRRRPCPGGLVSRVPTSSYGFSLSERGKNWSFVVKA 67 Query: 295 EANPEADL 318 E A++ Sbjct: 68 EEESNAEV 75