BLASTX nr result
ID: Mentha24_contig00007137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00007137 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19455.1| hypothetical protein MIMGU_mgv1a013552mg [Mimulus... 60 3e-07 >gb|EYU19455.1| hypothetical protein MIMGU_mgv1a013552mg [Mimulus guttatus] Length = 217 Score = 60.1 bits (144), Expect = 3e-07 Identities = 37/77 (48%), Positives = 49/77 (63%), Gaps = 6/77 (7%) Frame = +2 Query: 26 MSSNILPQTLFMLPKCSAHCQPRNLAFSAAIS-RRPLAGGLASRVLMRPSGFNF----KN 190 M+S+ L Q LFM+P+ + C+ NLAFSAA+S RRP GGL SRV GF+ KN Sbjct: 1 MASSFLHQALFMVPRSTFECRSNNLAFSAAVSRRRPCPGGLVSRVPTSSYGFSLSERGKN 60 Query: 191 LSFSVRA-AEANPEADL 238 SF V+A E+N E ++ Sbjct: 61 WSFVVKAEEESNAEVEV 77