BLASTX nr result
ID: Mentha24_contig00006681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00006681 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19272.1| hypothetical protein MIMGU_mgv1a013313mg [Mimulus... 72 8e-11 ref|XP_002304297.2| hypothetical protein POPTR_0003s07810g [Popu... 61 2e-07 gb|EPS71594.1| hypothetical protein M569_03166 [Genlisea aurea] 58 1e-06 ref|XP_007209599.1| hypothetical protein PRUPE_ppa011434mg [Prun... 58 1e-06 ref|XP_007209598.1| hypothetical protein PRUPE_ppa011434mg [Prun... 58 1e-06 ref|XP_004300359.1| PREDICTED: deSI-like protein At4g17486-like ... 57 2e-06 ref|XP_004300358.1| PREDICTED: deSI-like protein At4g17486-like ... 57 2e-06 >gb|EYU19272.1| hypothetical protein MIMGU_mgv1a013313mg [Mimulus guttatus] Length = 224 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = +1 Query: 190 MRLFPISTSSENSPKAEQNNSEKSEAPLYLNIYDLTPMNNYLYW 321 MRLFP+S+S ++SP EQNN+EKS+A LYLN+YDLTP+NNYLYW Sbjct: 1 MRLFPVSSSLDSSP-TEQNNTEKSQAMLYLNVYDLTPVNNYLYW 43 >ref|XP_002304297.2| hypothetical protein POPTR_0003s07810g [Populus trichocarpa] gi|550342664|gb|EEE79276.2| hypothetical protein POPTR_0003s07810g [Populus trichocarpa] Length = 231 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 2/46 (4%) Frame = +1 Query: 190 MRLFPISTSSENSPKAE--QNNSEKSEAPLYLNIYDLTPMNNYLYW 321 MRLFP+S+SS +S + E Q+N S LYLNIYDLTP+NNYLYW Sbjct: 1 MRLFPLSSSSSSSSEKEKEQSNGGSSRVMLYLNIYDLTPINNYLYW 46 >gb|EPS71594.1| hypothetical protein M569_03166 [Genlisea aurea] Length = 230 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +1 Query: 190 MRLFPISTSSENSPKAEQNNSEKSEAPLYLNIYDLTPMNNYLYW 321 MRLFPIS+ S++S +Q +EKS LYLN+YDLTP+NNYLYW Sbjct: 1 MRLFPISSISDDS-LGDQKIAEKSCTMLYLNVYDLTPINNYLYW 43 >ref|XP_007209599.1| hypothetical protein PRUPE_ppa011434mg [Prunus persica] gi|462405334|gb|EMJ10798.1| hypothetical protein PRUPE_ppa011434mg [Prunus persica] Length = 169 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 4/48 (8%) Frame = +1 Query: 190 MRLFPISTS----SENSPKAEQNNSEKSEAPLYLNIYDLTPMNNYLYW 321 MRLFP+S+S S +S + E+ + +K+ A LYLN+YDLTP+NNYLYW Sbjct: 1 MRLFPLSSSPTSTSTSSTEKEKTDRKKNRALLYLNVYDLTPVNNYLYW 48 >ref|XP_007209598.1| hypothetical protein PRUPE_ppa011434mg [Prunus persica] gi|462405333|gb|EMJ10797.1| hypothetical protein PRUPE_ppa011434mg [Prunus persica] Length = 210 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 4/48 (8%) Frame = +1 Query: 190 MRLFPISTS----SENSPKAEQNNSEKSEAPLYLNIYDLTPMNNYLYW 321 MRLFP+S+S S +S + E+ + +K+ A LYLN+YDLTP+NNYLYW Sbjct: 1 MRLFPLSSSPTSTSTSSTEKEKTDRKKNRALLYLNVYDLTPVNNYLYW 48 >ref|XP_004300359.1| PREDICTED: deSI-like protein At4g17486-like isoform 2 [Fragaria vesca subsp. vesca] Length = 232 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 4/48 (8%) Frame = +1 Query: 190 MRLFPI----STSSENSPKAEQNNSEKSEAPLYLNIYDLTPMNNYLYW 321 MRLFP+ S+SS ++ + EQ + +++ A LYLN+YDLTP+NNYLYW Sbjct: 1 MRLFPLNSTPSSSSSSTVEKEQTDRKRTRALLYLNVYDLTPVNNYLYW 48 >ref|XP_004300358.1| PREDICTED: deSI-like protein At4g17486-like isoform 1 [Fragaria vesca subsp. vesca] Length = 239 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 4/48 (8%) Frame = +1 Query: 190 MRLFPI----STSSENSPKAEQNNSEKSEAPLYLNIYDLTPMNNYLYW 321 MRLFP+ S+SS ++ + EQ + +++ A LYLN+YDLTP+NNYLYW Sbjct: 1 MRLFPLNSTPSSSSSSTVEKEQTDRKRTRALLYLNVYDLTPVNNYLYW 48