BLASTX nr result
ID: Mentha24_contig00006170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00006170 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28665.1| hypothetical protein MIMGU_mgv1a005027mg [Mimulus... 59 7e-07 >gb|EYU28665.1| hypothetical protein MIMGU_mgv1a005027mg [Mimulus guttatus] Length = 500 Score = 58.9 bits (141), Expect = 7e-07 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 1/70 (1%) Frame = -3 Query: 207 ERSKPQIPTPTRSKLKKNIRSRVVPFNCSENSDETPTNDEFE-DQKEFEDMSLIHRQLEQ 31 E KP I +R KN SRVVPFNC+ENS+ D + + E+ED+SLI +QL Q Sbjct: 346 ENKKPCINMNSR----KNFGSRVVPFNCNENSE---IGDGYAIKENEYEDLSLIRKQLLQ 398 Query: 30 IETQQSNLLE 1 IE QQSNLL+ Sbjct: 399 IENQQSNLLD 408