BLASTX nr result
ID: Mentha24_contig00006166
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00006166 (504 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31192.1| hypothetical protein MIMGU_mgv1a007062mg [Mimulus... 63 5e-08 >gb|EYU31192.1| hypothetical protein MIMGU_mgv1a007062mg [Mimulus guttatus] Length = 421 Score = 62.8 bits (151), Expect = 5e-08 Identities = 37/80 (46%), Positives = 50/80 (62%) Frame = +1 Query: 238 MKELALQYNIPLPPTTKYGISQRKTLPHFQSTRNQASKRVTNHGCASAGIRRKSTRPLQV 417 MKEL LQY IPLPPTTK +R+ LP FQ+T+ + ++ N+ A+A +T L V Sbjct: 1 MKELTLQYKIPLPPTTKLVHHKRRNLPQFQATKWRNTRTSVNYSSATAA----TTSSLGV 56 Query: 418 EEFEDGLGSSSYYVRVQDAG 477 E E+ GSS Y +R +DAG Sbjct: 57 LELEE--GSSGYNMRSKDAG 74