BLASTX nr result
ID: Mentha24_contig00006093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00006093 (780 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA15421.1| HMR1 protein [Antirrhinum majus] 91 5e-16 gb|EYU24123.1| hypothetical protein MIMGU_mgv1a007150mg [Mimulus... 87 7e-15 gb|AAA50196.1| DNA-binding protein [Nicotiana tabacum] 57 1e-05 gb|AAA34051.1| DNA-binding protein, partial [Nicotiana tabacum] 57 1e-05 >emb|CAA15421.1| HMR1 protein [Antirrhinum majus] Length = 400 Score = 90.9 bits (224), Expect = 5e-16 Identities = 46/65 (70%), Positives = 52/65 (80%) Frame = -3 Query: 196 KRRGRPPKAGSEAKKPRNMSAALPKSPRKLSGKPLGRPRKAAEEATVNRTPDSQLLVAYL 17 KRRGRPPKAG EAKKPR + PK+PRKLSGKPLGRP+K A A V++ D+QLLVAYL Sbjct: 283 KRRGRPPKAGGEAKKPRLQTVVKPKTPRKLSGKPLGRPKKNA-AAAVSQVADTQLLVAYL 341 Query: 16 DLKAK 2 DLK K Sbjct: 342 DLKGK 346 >gb|EYU24123.1| hypothetical protein MIMGU_mgv1a007150mg [Mimulus guttatus] Length = 417 Score = 87.0 bits (214), Expect = 7e-15 Identities = 44/65 (67%), Positives = 50/65 (76%) Frame = -3 Query: 196 KRRGRPPKAGSEAKKPRNMSAALPKSPRKLSGKPLGRPRKAAEEATVNRTPDSQLLVAYL 17 KRRGRPP+A AKK R++ A PK PRK SG+PLGRPRK + A RTPDSQLLVAYL Sbjct: 293 KRRGRPPRADGTAKKQRHLIAVQPKKPRKFSGRPLGRPRK-NDAAVAARTPDSQLLVAYL 351 Query: 16 DLKAK 2 DLK+K Sbjct: 352 DLKSK 356 >gb|AAA50196.1| DNA-binding protein [Nicotiana tabacum] Length = 546 Score = 56.6 bits (135), Expect = 1e-05 Identities = 34/65 (52%), Positives = 40/65 (61%) Frame = -3 Query: 196 KRRGRPPKAGSEAKKPRNMSAALPKSPRKLSGKPLGRPRKAAEEATVNRTPDSQLLVAYL 17 KRRGRPPK+ A +A K PRKLSGKPLGRPRK V+ D +L+VAY Sbjct: 442 KRRGRPPKSYGAAA-----AAPTVKRPRKLSGKPLGRPRKNVTSPAVS---DPKLVVAYE 493 Query: 16 DLKAK 2 +LK K Sbjct: 494 ELKGK 498 >gb|AAA34051.1| DNA-binding protein, partial [Nicotiana tabacum] Length = 380 Score = 56.6 bits (135), Expect = 1e-05 Identities = 34/65 (52%), Positives = 40/65 (61%) Frame = -3 Query: 196 KRRGRPPKAGSEAKKPRNMSAALPKSPRKLSGKPLGRPRKAAEEATVNRTPDSQLLVAYL 17 KRRGRPPK+ A +A K PRKLSGKPLGRPRK V+ D +L+VAY Sbjct: 276 KRRGRPPKSYGAAA-----AAPTVKRPRKLSGKPLGRPRKNVTSPAVS---DPKLVVAYE 327 Query: 16 DLKAK 2 +LK K Sbjct: 328 ELKGK 332