BLASTX nr result
ID: Mentha24_contig00006092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00006092 (725 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA15421.1| HMR1 protein [Antirrhinum majus] 84 5e-14 gb|EYU24123.1| hypothetical protein MIMGU_mgv1a007150mg [Mimulus... 82 1e-13 >emb|CAA15421.1| HMR1 protein [Antirrhinum majus] Length = 400 Score = 84.0 bits (206), Expect = 5e-14 Identities = 43/63 (68%), Positives = 49/63 (77%) Frame = -2 Query: 190 VTGKRRGRPPKAGSEAKKPRNMSAALPKSPRKLSGKPLGRPRKAAEEATVNRTPDSQLLV 11 V KRRGRPPKAG EAKKPR + PK+PRKLSGKPLGRP+K A A V++ D+QLLV Sbjct: 280 VAPKRRGRPPKAGGEAKKPRLQTVVKPKTPRKLSGKPLGRPKKNA-AAAVSQVADTQLLV 338 Query: 10 AYL 2 AYL Sbjct: 339 AYL 341 >gb|EYU24123.1| hypothetical protein MIMGU_mgv1a007150mg [Mimulus guttatus] Length = 417 Score = 82.4 bits (202), Expect = 1e-13 Identities = 42/63 (66%), Positives = 47/63 (74%) Frame = -2 Query: 190 VTGKRRGRPPKAGSEAKKPRNMSAALPKSPRKLSGKPLGRPRKAAEEATVNRTPDSQLLV 11 V GKRRGRPP+A AKK R++ A PK PRK SG+PLGRPRK + A RTPDSQLLV Sbjct: 290 VMGKRRGRPPRADGTAKKQRHLIAVQPKKPRKFSGRPLGRPRK-NDAAVAARTPDSQLLV 348 Query: 10 AYL 2 AYL Sbjct: 349 AYL 351