BLASTX nr result
ID: Mentha24_contig00004422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00004422 (650 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB78116.1| hypothetical protein L484_004818 [Morus notabilis] 56 8e-06 >gb|EXB78116.1| hypothetical protein L484_004818 [Morus notabilis] Length = 130 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = -2 Query: 118 RAAMGQPRXXXXXXXXXVYNRWNGILVPEYGFVHLDLIP 2 + A+GQPR +YNRWNGILVPEYGF+HL+LIP Sbjct: 62 KGAIGQPRMLVPFVLVMLYNRWNGILVPEYGFMHLELIP 100