BLASTX nr result
ID: Mentha24_contig00004235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00004235 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEQ61905.1| NAC domain-containing protein 1 [Salvia miltiorrh... 80 3e-13 gb|ABS80935.1| putative NAC transcription factor [Avicennia marina] 79 7e-13 gb|EPS70912.1| hypothetical protein M569_03847 [Genlisea aurea] 71 1e-10 ref|XP_007048529.1| NAC domain transcriptional regulator superfa... 65 8e-09 gb|ADQ08688.1| NAC transcription factor [Nicotiana tabacum] 60 2e-07 gb|AAM34766.1|AF509866_1 nam-like protein 3 [Petunia x hybrida] 60 4e-07 >gb|AEQ61905.1| NAC domain-containing protein 1 [Salvia miltiorrhiza] Length = 292 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/52 (71%), Positives = 44/52 (84%), Gaps = 4/52 (7%) Frame = +1 Query: 7 KWSEIDSYLDTQLNYMD--GFQDNLFNS--QMQFNDQFPLFPDMFAYMQKPF 150 KWSE D+YLDTQLN+MD GFQDN +N+ QMQ+ DQFPLF DM+A+MQKPF Sbjct: 241 KWSEFDTYLDTQLNFMDAGGFQDNFYNAGAQMQYTDQFPLFSDMYAFMQKPF 292 >gb|ABS80935.1| putative NAC transcription factor [Avicennia marina] Length = 303 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +1 Query: 4 PKWSEIDSYLDTQLNYMDGFQDNLFNSQMQFNDQFPLFPDMFAYMQKPF 150 PKWSE++S LD L YMDGFQD+ F SQMQ+ DQ LFPDM+AYMQKPF Sbjct: 255 PKWSELESTLDFPLIYMDGFQDDPFGSQMQYGDQLSLFPDMYAYMQKPF 303 >gb|EPS70912.1| hypothetical protein M569_03847 [Genlisea aurea] Length = 301 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/52 (65%), Positives = 40/52 (76%), Gaps = 2/52 (3%) Frame = +1 Query: 1 QPKWSEIDSYLDTQLNYMDGFQDNLFNSQM-QFND-QFPLFPDMFAYMQKPF 150 +PKWSE D LD QLNYM+GFQD++F SQM +ND Q +F DMF YMQKPF Sbjct: 250 EPKWSEFDGSLDYQLNYMEGFQDDIFGSQMPSYNDHQMNMFQDMFPYMQKPF 301 >ref|XP_007048529.1| NAC domain transcriptional regulator superfamily protein [Theobroma cacao] gi|508700790|gb|EOX92686.1| NAC domain transcriptional regulator superfamily protein [Theobroma cacao] Length = 296 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/51 (58%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = +1 Query: 1 QPKWSEIDSYLDTQLNYMDGFQDNLFNSQMQFN-DQFPLFPDMFAYMQKPF 150 +PKW+E+ S LD Q NYMDGFQD+ F SQ+Q+ DQ DMFA++QKPF Sbjct: 246 EPKWNELSSALDFQFNYMDGFQDDPFASQVQYQMDQLSPLQDMFAFLQKPF 296 >gb|ADQ08688.1| NAC transcription factor [Nicotiana tabacum] Length = 311 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 4/53 (7%) Frame = +1 Query: 4 PKWSEIDSYLDTQLNYMDGFQDNLFNSQMQFN----DQFPLFPDMFAYMQKPF 150 PKW ++D+ LD QLNY+D FQ + F QMQ DQF F DMF YMQKP+ Sbjct: 259 PKWDDLDNALDFQLNYLDSFQYDPFEPQMQQQNCNIDQFNSFQDMFVYMQKPY 311 >gb|AAM34766.1|AF509866_1 nam-like protein 3 [Petunia x hybrida] Length = 312 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/54 (53%), Positives = 35/54 (64%), Gaps = 5/54 (9%) Frame = +1 Query: 4 PKWSEIDSYLDTQLNYMDGFQDNLFNSQMQ-----FNDQFPLFPDMFAYMQKPF 150 P W +++S L+ QLNY+DGFQD F QMQ DQF F DMF YMQKP+ Sbjct: 259 PTWEDLESALNYQLNYLDGFQDEPFGPQMQQQNCNIIDQFNPFHDMFMYMQKPY 312