BLASTX nr result
ID: Mentha24_contig00004099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00004099 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41268.1| hypothetical protein MIMGU_mgv1a009961mg [Mimulus... 77 3e-12 >gb|EYU41268.1| hypothetical protein MIMGU_mgv1a009961mg [Mimulus guttatus] Length = 326 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = +3 Query: 222 MRTSLFSRRTIRQGAMSAFGSARMKLMLACCVLFTLIALASLTTSYGGWKRYA 380 MRTSLFSRRTIRQGA+ A GSA++KLMLACC+L TLIA + T S+ GW +YA Sbjct: 1 MRTSLFSRRTIRQGAVFAAGSAKIKLMLACCLLLTLIAFSGRTPSFIGWNQYA 53