BLASTX nr result
ID: Mentha24_contig00003835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00003835 (456 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006354774.1| PREDICTED: chlorophyll a-b binding protein 4... 86 5e-15 ref|XP_004241587.1| PREDICTED: chlorophyll a-b binding protein 4... 86 5e-15 ref|XP_004236014.1| PREDICTED: chlorophyll a-b binding protein P... 84 2e-14 ref|XP_002514741.1| chlorophyll A/B binding protein, putative [R... 84 2e-14 ref|XP_004973512.1| PREDICTED: chlorophyll a-b binding protein P... 84 2e-14 ref|NP_001150371.1| LOC100284001 [Zea mays] gi|195638726|gb|ACG3... 84 2e-14 gb|ACG35965.1| chlorophyll a-b binding protein 4 [Zea mays] 84 2e-14 gb|ACF86037.1| unknown [Zea mays] gi|195613086|gb|ACG28373.1| ch... 84 2e-14 ref|XP_006374464.1| hypothetical protein POPTR_0015s07340g [Popu... 83 4e-14 ref|XP_006374459.1| hypothetical protein POPTR_0015s07340g [Popu... 83 4e-14 ref|XP_006374463.1| Chlorophyll a-b binding protein 4 [Populus t... 83 4e-14 emb|CAE30280.1| chlorophyll a /b binding protein [Beta vulgaris] 83 5e-14 gb|ACB05669.1| chloroplast chlorophyll a/b binding protein [Caps... 82 6e-14 ref|XP_004513901.1| PREDICTED: chlorophyll a-b binding protein P... 82 8e-14 gb|ACJ85068.1| unknown [Medicago truncatula] gi|388507876|gb|AFK... 82 8e-14 ref|NP_001275056.1| chlorophyll a-b binding protein 4, chloropla... 82 8e-14 gb|EYU24361.1| hypothetical protein MIMGU_mgv1a012416mg [Mimulus... 82 1e-13 gb|EYU24360.1| hypothetical protein MIMGU_mgv1a012416mg [Mimulus... 82 1e-13 ref|XP_004138171.1| PREDICTED: chlorophyll a-b binding protein P... 82 1e-13 gb|AFK37078.1| unknown [Lotus japonicus] 82 1e-13 >ref|XP_006354774.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like [Solanum tuberosum] Length = 250 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFSN 338 LAFLGFI+QHNVTGKGPFDNLLQH+SDPWHNTIIQTFSN Sbjct: 212 LAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIIQTFSN 250 >ref|XP_004241587.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like [Solanum lycopersicum] Length = 250 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFSN 338 LAFLGFI+QHNVTGKGPFDNLLQH+SDPWHNTIIQTFSN Sbjct: 212 LAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIIQTFSN 250 >ref|XP_004236014.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like [Solanum lycopersicum] Length = 287 Score = 84.3 bits (207), Expect = 2e-14 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFSN 338 LAFLGFI+QHNVTGKGPFDNLLQHLSDPWHNTIIQT SN Sbjct: 249 LAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTLSN 287 >ref|XP_002514741.1| chlorophyll A/B binding protein, putative [Ricinus communis] gi|223546345|gb|EEF47847.1| chlorophyll A/B binding protein, putative [Ricinus communis] Length = 251 Score = 84.3 bits (207), Expect = 2e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 341 LAFLGF+IQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS Sbjct: 212 LAFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 249 >ref|XP_004973512.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like [Setaria italica] Length = 245 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 341 LAFLGF+IQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS Sbjct: 207 LAFLGFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 244 >ref|NP_001150371.1| LOC100284001 [Zea mays] gi|195638726|gb|ACG38831.1| chlorophyll a-b binding protein 4 [Zea mays] Length = 247 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 341 LAFLGF+IQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS Sbjct: 209 LAFLGFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 246 >gb|ACG35965.1| chlorophyll a-b binding protein 4 [Zea mays] Length = 247 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 341 LAFLGF+IQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS Sbjct: 209 LAFLGFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 246 >gb|ACF86037.1| unknown [Zea mays] gi|195613086|gb|ACG28373.1| chlorophyll a-b binding protein 4 [Zea mays] gi|414870433|tpg|DAA48990.1| TPA: chlorophyll a-b binding protein 4 [Zea mays] Length = 247 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 341 LAFLGF+IQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS Sbjct: 209 LAFLGFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 246 >ref|XP_006374464.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa] gi|550322228|gb|ERP52261.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa] Length = 252 Score = 83.2 bits (204), Expect = 4e-14 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 341 LAFLGF+IQHNVTGKGPFDNLLQH+SDPWHNTI+QTFS Sbjct: 212 LAFLGFVIQHNVTGKGPFDNLLQHISDPWHNTIVQTFS 249 >ref|XP_006374459.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa] gi|566206407|ref|XP_006374460.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa] gi|550322223|gb|ERP52256.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa] gi|550322224|gb|ERP52257.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa] Length = 150 Score = 83.2 bits (204), Expect = 4e-14 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 341 LAFLGF+IQHNVTGKGPFDNLLQH+SDPWHNTI+QTFS Sbjct: 111 LAFLGFVIQHNVTGKGPFDNLLQHISDPWHNTIVQTFS 148 >ref|XP_006374463.1| Chlorophyll a-b binding protein 4 [Populus trichocarpa] gi|118489040|gb|ABK96327.1| unknown [Populus trichocarpa x Populus deltoides] gi|550322227|gb|ERP52260.1| Chlorophyll a-b binding protein 4 [Populus trichocarpa] Length = 251 Score = 83.2 bits (204), Expect = 4e-14 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 341 LAFLGF+IQHNVTGKGPFDNLLQH+SDPWHNTI+QTFS Sbjct: 212 LAFLGFVIQHNVTGKGPFDNLLQHISDPWHNTIVQTFS 249 >emb|CAE30280.1| chlorophyll a /b binding protein [Beta vulgaris] Length = 252 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 344 LAFLGFI+QHNVTGKGPFDNLLQHLSDPWHNTIIQTF Sbjct: 213 LAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 249 >gb|ACB05669.1| chloroplast chlorophyll a/b binding protein [Capsicum annuum] Length = 250 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFSN 338 LAFLGFI+QHNVTGKGPFDNLLQHLSDPWHNTIIQT S+ Sbjct: 211 LAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTLSS 249 >ref|XP_004513901.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like [Cicer arietinum] Length = 252 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 341 LAFLGFI+QHNVTGKGPFDNLLQHLSDPWHNTIIQT S Sbjct: 213 LAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTLS 250 >gb|ACJ85068.1| unknown [Medicago truncatula] gi|388507876|gb|AFK42004.1| unknown [Medicago truncatula] Length = 253 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 341 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTI+QT S Sbjct: 213 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIVQTLS 250 >ref|NP_001275056.1| chlorophyll a-b binding protein 4, chloroplastic-like [Solanum tuberosum] gi|100801744|emb|CAK24966.1| chlorophyll a/b binding protein [Solanum tuberosum] Length = 251 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFSN 338 LAFLGFI+QHNVTGKGPFDNLLQHL DPWHNTIIQT SN Sbjct: 213 LAFLGFIVQHNVTGKGPFDNLLQHLFDPWHNTIIQTLSN 251 >gb|EYU24361.1| hypothetical protein MIMGU_mgv1a012416mg [Mimulus guttatus] Length = 186 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFSN 338 LAFLGF++QHNVTGKG FDNLLQHLSDPWHNTIIQTF N Sbjct: 148 LAFLGFVVQHNVTGKGAFDNLLQHLSDPWHNTIIQTFKN 186 >gb|EYU24360.1| hypothetical protein MIMGU_mgv1a012416mg [Mimulus guttatus] Length = 251 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFSN 338 LAFLGF++QHNVTGKG FDNLLQHLSDPWHNTIIQTF N Sbjct: 213 LAFLGFVVQHNVTGKGAFDNLLQHLSDPWHNTIIQTFKN 251 >ref|XP_004138171.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like [Cucumis sativus] gi|449477217|ref|XP_004154963.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like [Cucumis sativus] Length = 252 Score = 81.6 bits (200), Expect = 1e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 344 LAFLGFI+QHNVTGKGPFDNLLQH+SDPWHNTI+QTF Sbjct: 213 LAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIVQTF 249 >gb|AFK37078.1| unknown [Lotus japonicus] Length = 252 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 454 LAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFS 341 LAFLGFI+QHNVTGKGPFDNLLQHLSDPWHNTI+QT S Sbjct: 213 LAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLS 250