BLASTX nr result
ID: Mentha24_contig00003819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00003819 (600 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21570.1| hypothetical protein MIMGU_mgv1a006029mg [Mimulus... 102 6e-20 gb|EXC25826.1| hypothetical protein L484_019460 [Morus notabilis] 102 6e-20 ref|XP_006385487.1| hypothetical protein POPTR_0003s057201g, par... 101 1e-19 ref|XP_006343101.1| PREDICTED: D-glycerate 3-kinase, chloroplast... 99 1e-18 ref|XP_004302939.1| PREDICTED: D-glycerate 3-kinase, chloroplast... 99 1e-18 ref|XP_007024030.1| P-loop containing nucleoside triphosphate hy... 98 2e-18 ref|XP_004235693.1| PREDICTED: D-glycerate 3-kinase, chloroplast... 98 2e-18 ref|XP_002517532.1| D-glycerate 3-kinase, chloroplast precursor,... 98 2e-18 ref|XP_007150687.1| hypothetical protein PHAVU_005G173200g [Phas... 97 3e-18 ref|XP_002298133.2| hypothetical protein POPTR_0001s17750g [Popu... 97 3e-18 ref|XP_006302248.1| hypothetical protein CARUB_v10020281mg [Caps... 97 5e-18 gb|AAL16169.1|AF428401_1 At1g80380/F5I6_13 [Arabidopsis thaliana] 97 5e-18 gb|AAG52441.1|AC018848_12 unknown protein; 45415-47304 [Arabidop... 97 5e-18 ref|NP_565237.1| D-glycerate 3-kinase [Arabidopsis thaliana] gi|... 97 5e-18 ref|NP_849912.1| D-glycerate 3-kinase [Arabidopsis thaliana] gi|... 97 5e-18 ref|NP_001185447.1| D-glycerate 3-kinase [Arabidopsis thaliana] ... 97 5e-18 ref|XP_002889295.1| predicted protein [Arabidopsis lyrata subsp.... 97 5e-18 ref|NP_001077855.1| D-glycerate 3-kinase [Arabidopsis thaliana] ... 97 5e-18 gb|AAM61346.1| unknown [Arabidopsis thaliana] 97 5e-18 ref|XP_003543660.1| PREDICTED: D-glycerate 3-kinase, chloroplast... 96 8e-18 >gb|EYU21570.1| hypothetical protein MIMGU_mgv1a006029mg [Mimulus guttatus] Length = 460 Score = 102 bits (255), Expect = 6e-20 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 442 G+SDEEVLDFVSRYLPAYKAYLPTLYAEGP GSDP HLLVVEIDEGRNPIL + Sbjct: 408 GLSDEEVLDFVSRYLPAYKAYLPTLYAEGPKGSDPNHLLVVEIDEGRNPILGS 460 >gb|EXC25826.1| hypothetical protein L484_019460 [Morus notabilis] Length = 437 Score = 102 bits (255), Expect = 6e-20 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 442 GMSDEEV DFVSRYLPAY AYLPTLY+EGP+GSDP+HLLV+EIDEGRNPILAN Sbjct: 385 GMSDEEVKDFVSRYLPAYNAYLPTLYSEGPNGSDPDHLLVIEIDEGRNPILAN 437 >ref|XP_006385487.1| hypothetical protein POPTR_0003s057201g, partial [Populus trichocarpa] gi|550342489|gb|ERP63284.1| hypothetical protein POPTR_0003s057201g, partial [Populus trichocarpa] Length = 103 Score = 101 bits (252), Expect = 1e-19 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 442 GM+DEEV DFVSRYLPAYKAYLPTLYAEGP+GSDPE+LLV+EIDEGRNPIL N Sbjct: 51 GMTDEEVKDFVSRYLPAYKAYLPTLYAEGPNGSDPENLLVIEIDEGRNPILGN 103 >ref|XP_006343101.1| PREDICTED: D-glycerate 3-kinase, chloroplastic-like [Solanum tuberosum] Length = 382 Score = 98.6 bits (244), Expect = 1e-18 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPIL 448 GM+DEEV DFVSRYLPAYKAYLPTLY+EGPSGSDPEH+L+++IDEGRNPIL Sbjct: 330 GMTDEEVKDFVSRYLPAYKAYLPTLYSEGPSGSDPEHVLLIDIDEGRNPIL 380 >ref|XP_004302939.1| PREDICTED: D-glycerate 3-kinase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 452 Score = 98.6 bits (244), Expect = 1e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 442 GMSD+EV DFVSRYLPAY AYLPTLY+EGP GSDP+HL+VVEIDEGRNPIL N Sbjct: 400 GMSDDEVKDFVSRYLPAYNAYLPTLYSEGPRGSDPKHLIVVEIDEGRNPILGN 452 >ref|XP_007024030.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein [Theobroma cacao] gi|508779396|gb|EOY26652.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein [Theobroma cacao] Length = 448 Score = 98.2 bits (243), Expect = 2e-18 Identities = 45/53 (84%), Positives = 51/53 (96%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 442 GMSDEEV DFVSRYLPAYKAYLPTLY+EGP+GSDP+ LL++EIDEGRNPILA+ Sbjct: 396 GMSDEEVKDFVSRYLPAYKAYLPTLYSEGPNGSDPKRLLLIEIDEGRNPILAD 448 >ref|XP_004235693.1| PREDICTED: D-glycerate 3-kinase, chloroplastic-like [Solanum lycopersicum] Length = 452 Score = 98.2 bits (243), Expect = 2e-18 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPIL 448 GMSDEEV DFVSRYLPAYKAYLPTLY+EGPSGSDP+H+L+++IDEGRNPIL Sbjct: 400 GMSDEEVKDFVSRYLPAYKAYLPTLYSEGPSGSDPKHVLLIDIDEGRNPIL 450 >ref|XP_002517532.1| D-glycerate 3-kinase, chloroplast precursor, putative [Ricinus communis] gi|223543164|gb|EEF44696.1| D-glycerate 3-kinase, chloroplast precursor, putative [Ricinus communis] Length = 463 Score = 97.8 bits (242), Expect = 2e-18 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILA 445 GM+DEEV DFVSRYLPAYKAYLPTLYAEGPSGSDPE++L+VEIDE RNPILA Sbjct: 411 GMTDEEVKDFVSRYLPAYKAYLPTLYAEGPSGSDPENVLLVEIDEARNPILA 462 >ref|XP_007150687.1| hypothetical protein PHAVU_005G173200g [Phaseolus vulgaris] gi|561023951|gb|ESW22681.1| hypothetical protein PHAVU_005G173200g [Phaseolus vulgaris] Length = 437 Score = 97.1 bits (240), Expect = 3e-18 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILA 445 GM+DEEV DFVSRYLPAY AYLPTLY+EGP+GSDP+HLL +EIDEGRNPILA Sbjct: 385 GMTDEEVRDFVSRYLPAYYAYLPTLYSEGPNGSDPQHLLTIEIDEGRNPILA 436 >ref|XP_002298133.2| hypothetical protein POPTR_0001s17750g [Populus trichocarpa] gi|550347559|gb|EEE82938.2| hypothetical protein POPTR_0001s17750g [Populus trichocarpa] Length = 384 Score = 97.1 bits (240), Expect = 3e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 442 GM+DEEV DFVSRYLPAYKAYLPTLYAEGP GS PE+LL++EIDEGRNPIL N Sbjct: 332 GMTDEEVKDFVSRYLPAYKAYLPTLYAEGPRGSHPENLLLIEIDEGRNPILGN 384 >ref|XP_006302248.1| hypothetical protein CARUB_v10020281mg [Capsella rubella] gi|482570958|gb|EOA35146.1| hypothetical protein CARUB_v10020281mg [Capsella rubella] Length = 454 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 442 GMSDEEV DFVSRYLPAYKAYLPTLYAEGPSGSDP+ +L ++IDE RNPILAN Sbjct: 402 GMSDEEVNDFVSRYLPAYKAYLPTLYAEGPSGSDPDRVLAIDIDEERNPILAN 454 >gb|AAL16169.1|AF428401_1 At1g80380/F5I6_13 [Arabidopsis thaliana] Length = 456 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 442 GMSDEEV DFVSRYLPAYKAYLPTLYAEGPSGSDP+ +L ++IDE RNPILAN Sbjct: 404 GMSDEEVNDFVSRYLPAYKAYLPTLYAEGPSGSDPDRVLAIDIDEERNPILAN 456 >gb|AAG52441.1|AC018848_12 unknown protein; 45415-47304 [Arabidopsis thaliana] Length = 389 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 442 GMSDEEV DFVSRYLPAYKAYLPTLYAEGPSGSDP+ +L ++IDE RNPILAN Sbjct: 337 GMSDEEVNDFVSRYLPAYKAYLPTLYAEGPSGSDPDRVLAIDIDEERNPILAN 389 >ref|NP_565237.1| D-glycerate 3-kinase [Arabidopsis thaliana] gi|332198273|gb|AEE36394.1| D-glycerate 3-kinase [Arabidopsis thaliana] Length = 362 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 442 GMSDEEV DFVSRYLPAYKAYLPTLYAEGPSGSDP+ +L ++IDE RNPILAN Sbjct: 310 GMSDEEVNDFVSRYLPAYKAYLPTLYAEGPSGSDPDRVLAIDIDEERNPILAN 362 >ref|NP_849912.1| D-glycerate 3-kinase [Arabidopsis thaliana] gi|73919691|sp|Q944I4.2|GLYK_ARATH RecName: Full=D-glycerate 3-kinase, chloroplastic; Short=AtGLYK; Flags: Precursor gi|13430488|gb|AAK25866.1|AF360156_1 unknown protein [Arabidopsis thaliana] gi|15810543|gb|AAL07159.1| unknown protein [Arabidopsis thaliana] gi|332198272|gb|AEE36393.1| D-glycerate 3-kinase [Arabidopsis thaliana] Length = 456 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 442 GMSDEEV DFVSRYLPAYKAYLPTLYAEGPSGSDP+ +L ++IDE RNPILAN Sbjct: 404 GMSDEEVNDFVSRYLPAYKAYLPTLYAEGPSGSDPDRVLAIDIDEERNPILAN 456 >ref|NP_001185447.1| D-glycerate 3-kinase [Arabidopsis thaliana] gi|332198275|gb|AEE36396.1| D-glycerate 3-kinase [Arabidopsis thaliana] Length = 450 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 442 GMSDEEV DFVSRYLPAYKAYLPTLYAEGPSGSDP+ +L ++IDE RNPILAN Sbjct: 398 GMSDEEVNDFVSRYLPAYKAYLPTLYAEGPSGSDPDRVLAIDIDEERNPILAN 450 >ref|XP_002889295.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297335136|gb|EFH65554.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 454 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 442 GMSDEEV DFVSRYLPAYKAYLPTLYAEGPSGSDP+ +L ++IDE RNPILAN Sbjct: 402 GMSDEEVNDFVSRYLPAYKAYLPTLYAEGPSGSDPDRVLAIDIDEERNPILAN 454 >ref|NP_001077855.1| D-glycerate 3-kinase [Arabidopsis thaliana] gi|332198274|gb|AEE36395.1| D-glycerate 3-kinase [Arabidopsis thaliana] Length = 364 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 442 GMSDEEV DFVSRYLPAYKAYLPTLYAEGPSGSDP+ +L ++IDE RNPILAN Sbjct: 312 GMSDEEVNDFVSRYLPAYKAYLPTLYAEGPSGSDPDRVLAIDIDEERNPILAN 364 >gb|AAM61346.1| unknown [Arabidopsis thaliana] Length = 362 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 442 GMSDEEV DFVSRYLPAYKAYLPTLYAEGPSGSDP+ +L ++IDE RNPILAN Sbjct: 310 GMSDEEVNDFVSRYLPAYKAYLPTLYAEGPSGSDPDRVLAIDIDEERNPILAN 362 >ref|XP_003543660.1| PREDICTED: D-glycerate 3-kinase, chloroplastic-like [Glycine max] Length = 434 Score = 95.9 bits (237), Expect = 8e-18 Identities = 43/52 (82%), Positives = 49/52 (94%) Frame = -1 Query: 600 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILA 445 GM+D+EV DFVSRYLPAY AYLPTLY+EGP+GSDP+HLL +EIDEGRNPILA Sbjct: 382 GMTDDEVRDFVSRYLPAYYAYLPTLYSEGPNGSDPQHLLTIEIDEGRNPILA 433