BLASTX nr result
ID: Mentha24_contig00003652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00003652 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value prf||1609235A chlorophyll a/b binding protein 80 4e-13 sp|P27522.1|CB13_SOLLC RecName: Full=Chlorophyll a-b binding pro... 80 4e-13 ref|XP_006360010.1| PREDICTED: chlorophyll a-b binding protein 8... 80 4e-13 ref|XP_007142544.1| hypothetical protein PHAVU_008G289700g [Phas... 80 4e-13 gb|ABX89589.1| Lhca3 [Solanum tuberosum] gi|162423648|gb|ABX8959... 80 4e-13 ref|XP_004965906.1| PREDICTED: chlorophyll a-b binding protein 8... 79 5e-13 ref|XP_004491629.1| PREDICTED: chlorophyll a-b binding protein 3... 79 5e-13 ref|XP_004303913.1| PREDICTED: chlorophyll a-b binding protein 8... 79 5e-13 ref|XP_007215737.1| hypothetical protein PRUPE_ppa009110mg [Prun... 79 5e-13 ref|XP_004248217.1| PREDICTED: chlorophyll a-b binding protein 8... 79 5e-13 gb|AFW87506.1| chlorophyll a-b binding protein 8 [Zea mays] 79 5e-13 gb|AFK45661.1| unknown [Medicago truncatula] 79 5e-13 ref|XP_003618083.1| Chlorophyll a-b binding protein [Medicago tr... 79 5e-13 ref|XP_003618082.1| Chlorophyll a-b binding protein [Medicago tr... 79 5e-13 ref|NP_001148598.1| chlorophyll a-b binding protein 8 [Zea mays]... 79 5e-13 gb|ACG28457.1| chlorophyll a-b binding protein 8 [Zea mays] gi|2... 79 5e-13 gb|EYU26223.1| hypothetical protein MIMGU_mgv1a011622mg [Mimulus... 79 7e-13 ref|XP_006350000.1| PREDICTED: chlorophyll a-b binding protein 8... 78 1e-12 ref|XP_006302674.1| hypothetical protein CARUB_v10020781mg [Caps... 78 1e-12 gb|AAA18206.1| PSI type III chlorophyll a/b-binding protein [Ara... 78 1e-12 >prf||1609235A chlorophyll a/b binding protein Length = 273 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQALVTGVGP+QNLLDHLADPVNNNVLTSLKFH Sbjct: 236 ILGYFIQALVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >sp|P27522.1|CB13_SOLLC RecName: Full=Chlorophyll a-b binding protein 8, chloroplastic; AltName: Full=LHCI type III CAB-8; Flags: Precursor gi|19182|emb|CAA33330.1| Type III chlorophyll a/b-binding protein [Solanum lycopersicum] Length = 273 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQALVTGVGP+QNLLDHLADPVNNNVLTSLKFH Sbjct: 236 ILGYFIQALVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >ref|XP_006360010.1| PREDICTED: chlorophyll a-b binding protein 8, chloroplastic-like [Solanum tuberosum] Length = 273 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQALVTGVGP+QNLLDHLADPVNNNVLTSLKFH Sbjct: 236 ILGYFIQALVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >ref|XP_007142544.1| hypothetical protein PHAVU_008G289700g [Phaseolus vulgaris] gi|543176847|gb|AGV54446.1| chlorophyll A/B binding protein 8 [Phaseolus vulgaris] gi|543177716|gb|AGV54878.1| chlorophyll A/B binding protein 3 chloroplastic-like isoform 1 [Phaseolus vulgaris] gi|558695564|gb|AHA84135.1| chlorophyll a/b-binding protein type III precursor [Phaseolus vulgaris] gi|561015677|gb|ESW14538.1| hypothetical protein PHAVU_008G289700g [Phaseolus vulgaris] Length = 276 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQALVTGVGP+QNLLDHLADPVNNNVLTSLKFH Sbjct: 239 ILGYFIQALVTGVGPYQNLLDHLADPVNNNVLTSLKFH 276 >gb|ABX89589.1| Lhca3 [Solanum tuberosum] gi|162423648|gb|ABX89590.1| Lhca3 [Solanum tuberosum] Length = 45 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQALVTGVGP+QNLLDHLADPVNNNVLTSLKFH Sbjct: 8 ILGYFIQALVTGVGPYQNLLDHLADPVNNNVLTSLKFH 45 >ref|XP_004965906.1| PREDICTED: chlorophyll a-b binding protein 8, chloroplastic-like [Setaria italica] Length = 266 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQ LVTGVGPFQNLLDHLADPVNNNVLTSLKFH Sbjct: 229 ILGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH 266 >ref|XP_004491629.1| PREDICTED: chlorophyll a-b binding protein 3, chloroplastic-like [Cicer arietinum] Length = 276 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQ LVTGVGPFQNLLDHLADPVNNNVLTSLKFH Sbjct: 239 ILGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH 276 >ref|XP_004303913.1| PREDICTED: chlorophyll a-b binding protein 8, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 276 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQALVTGVGP+QNLLDHLADPVNNN+LTSLKFH Sbjct: 239 ILGYFIQALVTGVGPYQNLLDHLADPVNNNILTSLKFH 276 >ref|XP_007215737.1| hypothetical protein PRUPE_ppa009110mg [Prunus persica] gi|462411887|gb|EMJ16936.1| hypothetical protein PRUPE_ppa009110mg [Prunus persica] Length = 306 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQ LVTGVGPFQNLLDHLADPVNNNVLTSLKFH Sbjct: 269 ILGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH 306 >ref|XP_004248217.1| PREDICTED: chlorophyll a-b binding protein 8, chloroplastic-like [Solanum lycopersicum] Length = 273 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 +LGYFIQALVTGVGP+QNLLDHLADPVNNNVLTSLKFH Sbjct: 236 VLGYFIQALVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >gb|AFW87506.1| chlorophyll a-b binding protein 8 [Zea mays] Length = 209 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQ LVTGVGPFQNLLDHLADPVNNNVLTSLKFH Sbjct: 172 ILGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH 209 >gb|AFK45661.1| unknown [Medicago truncatula] Length = 277 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQALVTGVGP+QNLLDHLADPVNNN+LTSLKFH Sbjct: 240 ILGYFIQALVTGVGPYQNLLDHLADPVNNNILTSLKFH 277 >ref|XP_003618083.1| Chlorophyll a-b binding protein [Medicago truncatula] gi|355519418|gb|AET01042.1| Chlorophyll a-b binding protein [Medicago truncatula] Length = 573 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQALVTGVGP+QNLLDHLADPVNNN+LTSLKFH Sbjct: 536 ILGYFIQALVTGVGPYQNLLDHLADPVNNNILTSLKFH 573 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSL 276 ILGYFIQALVTGVGP+QNLLDHLADPVNNN+LTSL Sbjct: 240 ILGYFIQALVTGVGPYQNLLDHLADPVNNNILTSL 274 >ref|XP_003618082.1| Chlorophyll a-b binding protein [Medicago truncatula] gi|355519417|gb|AET01041.1| Chlorophyll a-b binding protein [Medicago truncatula] Length = 557 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQALVTGVGP+QNLLDHLADPVNNN+LTSLKFH Sbjct: 520 ILGYFIQALVTGVGPYQNLLDHLADPVNNNILTSLKFH 557 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLK 273 ILGYFIQALVTGVGP+QNLLDHLADPVNNN+LTSLK Sbjct: 240 ILGYFIQALVTGVGPYQNLLDHLADPVNNNILTSLK 275 >ref|NP_001148598.1| chlorophyll a-b binding protein 8 [Zea mays] gi|195620680|gb|ACG32170.1| chlorophyll a-b binding protein 8 [Zea mays] Length = 151 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQ LVTGVGPFQNLLDHLADPVNNNVLTSLKFH Sbjct: 114 ILGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH 151 >gb|ACG28457.1| chlorophyll a-b binding protein 8 [Zea mays] gi|238013956|gb|ACR38013.1| unknown [Zea mays] gi|413954858|gb|AFW87507.1| chlorophyll a-b binding protein 8 [Zea mays] Length = 267 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQ LVTGVGPFQNLLDHLADPVNNNVLTSLKFH Sbjct: 230 ILGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 >gb|EYU26223.1| hypothetical protein MIMGU_mgv1a011622mg [Mimulus guttatus] Length = 276 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 +LGYFIQ LVTGVGPFQNLLDHLADPVNNNVLTSLKFH Sbjct: 239 VLGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH 276 >ref|XP_006350000.1| PREDICTED: chlorophyll a-b binding protein 8, chloroplastic-like [Solanum tuberosum] Length = 273 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQ LVTGVGP+QNLLDHLADPVNNNVLTSLKFH Sbjct: 236 ILGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >ref|XP_006302674.1| hypothetical protein CARUB_v10020781mg [Capsella rubella] gi|482571384|gb|EOA35572.1| hypothetical protein CARUB_v10020781mg [Capsella rubella] Length = 273 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQ LVTGVGP+QNLLDHLADPVNNNVLTSLKFH Sbjct: 236 ILGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273 >gb|AAA18206.1| PSI type III chlorophyll a/b-binding protein [Arabidopsis thaliana] Length = 273 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 380 ILGYFIQALVTGVGPFQNLLDHLADPVNNNVLTSLKFH 267 ILGYFIQ LVTGVGP+QNLLDHLADPVNNNVLTSLKFH Sbjct: 236 ILGYFIQGLVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273