BLASTX nr result
ID: Mentha24_contig00003618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00003618 (386 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006446498.1| hypothetical protein CICLE_v100152141mg, par... 131 9e-29 ref|XP_006446497.1| hypothetical protein CICLE_v100152141mg, par... 131 9e-29 ref|XP_002524640.1| Protease degQ precursor, putative [Ricinus c... 131 9e-29 ref|XP_004489277.1| PREDICTED: protease Do-like 1, chloroplastic... 131 1e-28 ref|XP_006844985.1| hypothetical protein AMTR_s00058p00188880 [A... 130 1e-28 ref|XP_004156682.1| PREDICTED: protease Do-like 1, chloroplastic... 130 1e-28 ref|XP_004142804.1| PREDICTED: protease Do-like 1, chloroplastic... 130 1e-28 ref|XP_004304622.1| PREDICTED: protease Do-like 1, chloroplastic... 130 2e-28 ref|XP_007215368.1| hypothetical protein PRUPE_ppa005605mg [Prun... 130 2e-28 ref|XP_003524545.1| PREDICTED: protease Do-like 1, chloroplastic... 129 3e-28 ref|XP_006338559.1| PREDICTED: protease Do-like 1, chloroplastic... 129 4e-28 ref|XP_007151040.1| hypothetical protein PHAVU_004G013600g [Phas... 129 4e-28 gb|ACZ74706.1| serine-type peptidase [Phaseolus vulgaris] 129 4e-28 ref|XP_006470331.1| PREDICTED: protease Do-like 1, chloroplastic... 128 7e-28 gb|EEE64736.1| hypothetical protein OsJ_19592 [Oryza sativa Japo... 128 7e-28 gb|EEC79717.1| hypothetical protein OsI_21033 [Oryza sativa Indi... 128 7e-28 ref|NP_001056360.1| Os05g0568900 [Oryza sativa Japonica Group] g... 128 7e-28 gb|EYU34714.1| hypothetical protein MIMGU_mgv1a006761mg [Mimulus... 128 9e-28 ref|NP_001242692.1| uncharacterized protein LOC100783304 [Glycin... 128 9e-28 ref|XP_004232295.1| PREDICTED: protease Do-like 1, chloroplastic... 127 1e-27 >ref|XP_006446498.1| hypothetical protein CICLE_v100152141mg, partial [Citrus clementina] gi|557549109|gb|ESR59738.1| hypothetical protein CICLE_v100152141mg, partial [Citrus clementina] Length = 215 Score = 131 bits (330), Expect = 9e-29 Identities = 63/70 (90%), Positives = 69/70 (98%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GLLSTKRDAYGRL+LGDIITSVNGKK++NGSDLYRILDQCKVGD+VIVEVLRGD+KEKIP Sbjct: 146 GLLSTKRDAYGRLILGDIITSVNGKKVSNGSDLYRILDQCKVGDEVIVEVLRGDQKEKIP 205 Query: 206 VVLEPKPDES 177 V LEPKPDE+ Sbjct: 206 VKLEPKPDET 215 >ref|XP_006446497.1| hypothetical protein CICLE_v100152141mg, partial [Citrus clementina] gi|557549108|gb|ESR59737.1| hypothetical protein CICLE_v100152141mg, partial [Citrus clementina] Length = 164 Score = 131 bits (330), Expect = 9e-29 Identities = 63/70 (90%), Positives = 69/70 (98%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GLLSTKRDAYGRL+LGDIITSVNGKK++NGSDLYRILDQCKVGD+VIVEVLRGD+KEKIP Sbjct: 95 GLLSTKRDAYGRLILGDIITSVNGKKVSNGSDLYRILDQCKVGDEVIVEVLRGDQKEKIP 154 Query: 206 VVLEPKPDES 177 V LEPKPDE+ Sbjct: 155 VKLEPKPDET 164 >ref|XP_002524640.1| Protease degQ precursor, putative [Ricinus communis] gi|223536001|gb|EEF37659.1| Protease degQ precursor, putative [Ricinus communis] Length = 451 Score = 131 bits (330), Expect = 9e-29 Identities = 64/70 (91%), Positives = 67/70 (95%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GL TKRDAYGRL+LGDIITSVNGKKITNGSDLYRILDQCKVGD+VIVEVLRGD KEKIP Sbjct: 382 GLQPTKRDAYGRLILGDIITSVNGKKITNGSDLYRILDQCKVGDQVIVEVLRGDHKEKIP 441 Query: 206 VVLEPKPDES 177 V+LEPKPDES Sbjct: 442 VILEPKPDES 451 >ref|XP_004489277.1| PREDICTED: protease Do-like 1, chloroplastic-like [Cicer arietinum] Length = 429 Score = 131 bits (329), Expect = 1e-28 Identities = 64/70 (91%), Positives = 67/70 (95%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GLLSTKRD+YGRL+LGDIITSVNGKK+TNGSDLYRILDQC VGDKVIVEVLRGD KEKIP Sbjct: 360 GLLSTKRDSYGRLILGDIITSVNGKKVTNGSDLYRILDQCNVGDKVIVEVLRGDHKEKIP 419 Query: 206 VVLEPKPDES 177 VVLEPK DES Sbjct: 420 VVLEPKADES 429 >ref|XP_006844985.1| hypothetical protein AMTR_s00058p00188880 [Amborella trichopoda] gi|548847476|gb|ERN06660.1| hypothetical protein AMTR_s00058p00188880 [Amborella trichopoda] Length = 444 Score = 130 bits (328), Expect = 1e-28 Identities = 62/70 (88%), Positives = 67/70 (95%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GL STKRDAYGRL+LGDIITSVNGKK+TNGSDLYRILDQCKVGD+V VEVLRGD KEK+P Sbjct: 375 GLQSTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGDQVTVEVLRGDHKEKVP 434 Query: 206 VVLEPKPDES 177 V+LEPKPDES Sbjct: 435 VILEPKPDES 444 >ref|XP_004156682.1| PREDICTED: protease Do-like 1, chloroplastic-like [Cucumis sativus] Length = 438 Score = 130 bits (328), Expect = 1e-28 Identities = 63/70 (90%), Positives = 66/70 (94%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GLL TKRDAYGRL+LGDIITSVNGKK+TNGSDLYRILDQCKVGDKV VEVLRGD EKIP Sbjct: 369 GLLPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGDKVTVEVLRGDHMEKIP 428 Query: 206 VVLEPKPDES 177 V+LEPKPDES Sbjct: 429 VILEPKPDES 438 >ref|XP_004142804.1| PREDICTED: protease Do-like 1, chloroplastic-like [Cucumis sativus] Length = 439 Score = 130 bits (328), Expect = 1e-28 Identities = 63/70 (90%), Positives = 66/70 (94%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GLL TKRDAYGRL+LGDIITSVNGKK+TNGSDLYRILDQCKVGDKV VEVLRGD EKIP Sbjct: 370 GLLPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGDKVTVEVLRGDHMEKIP 429 Query: 206 VVLEPKPDES 177 V+LEPKPDES Sbjct: 430 VILEPKPDES 439 >ref|XP_004304622.1| PREDICTED: protease Do-like 1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 441 Score = 130 bits (326), Expect = 2e-28 Identities = 63/70 (90%), Positives = 67/70 (95%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GLL TKRD+YGRL+LGDIITSVNGKK+TNGSDLYRILDQC VGDKVIVEVLRGD+KEKIP Sbjct: 372 GLLPTKRDSYGRLILGDIITSVNGKKVTNGSDLYRILDQCNVGDKVIVEVLRGDQKEKIP 431 Query: 206 VVLEPKPDES 177 VVLEPK DES Sbjct: 432 VVLEPKADES 441 >ref|XP_007215368.1| hypothetical protein PRUPE_ppa005605mg [Prunus persica] gi|462411518|gb|EMJ16567.1| hypothetical protein PRUPE_ppa005605mg [Prunus persica] Length = 452 Score = 130 bits (326), Expect = 2e-28 Identities = 63/70 (90%), Positives = 67/70 (95%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GLL TKRDAYGRL+LGDIITSVNGKK++NGSDLYRILDQCKVGDKV VEVLRGDKKEKIP Sbjct: 383 GLLPTKRDAYGRLILGDIITSVNGKKVSNGSDLYRILDQCKVGDKVTVEVLRGDKKEKIP 442 Query: 206 VVLEPKPDES 177 VVLEPK DE+ Sbjct: 443 VVLEPKADET 452 >ref|XP_003524545.1| PREDICTED: protease Do-like 1, chloroplastic-like [Glycine max] Length = 426 Score = 129 bits (325), Expect = 3e-28 Identities = 62/70 (88%), Positives = 67/70 (95%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GL STKRD+YGRL+LGDIITSVN KK+TNGSDLYRILDQCKVGDK+IVEVLRGD KEKIP Sbjct: 357 GLQSTKRDSYGRLILGDIITSVNDKKVTNGSDLYRILDQCKVGDKLIVEVLRGDHKEKIP 416 Query: 206 VVLEPKPDES 177 V+LEPKPDES Sbjct: 417 VILEPKPDES 426 >ref|XP_006338559.1| PREDICTED: protease Do-like 1, chloroplastic-like [Solanum tuberosum] Length = 430 Score = 129 bits (324), Expect = 4e-28 Identities = 60/70 (85%), Positives = 69/70 (98%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GLL TKRD+YGRL+LGDIITS+NGKK++NG+DLYRILDQCKVGDKVIVEVLRGD+KEKIP Sbjct: 361 GLLPTKRDSYGRLILGDIITSINGKKVSNGTDLYRILDQCKVGDKVIVEVLRGDQKEKIP 420 Query: 206 VVLEPKPDES 177 V+LEPKP+ES Sbjct: 421 VLLEPKPEES 430 >ref|XP_007151040.1| hypothetical protein PHAVU_004G013600g [Phaseolus vulgaris] gi|561024349|gb|ESW23034.1| hypothetical protein PHAVU_004G013600g [Phaseolus vulgaris] Length = 424 Score = 129 bits (324), Expect = 4e-28 Identities = 62/70 (88%), Positives = 67/70 (95%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GL STKRD+YGRL+LGDIITSVN KK+TNGSDLYRILDQCKVG+KVIVEVLRGD KEKIP Sbjct: 355 GLQSTKRDSYGRLILGDIITSVNDKKVTNGSDLYRILDQCKVGEKVIVEVLRGDHKEKIP 414 Query: 206 VVLEPKPDES 177 V+LEPKPDES Sbjct: 415 VILEPKPDES 424 >gb|ACZ74706.1| serine-type peptidase [Phaseolus vulgaris] Length = 424 Score = 129 bits (324), Expect = 4e-28 Identities = 62/70 (88%), Positives = 67/70 (95%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GL STKRD+YGRL+LGDIITSVN KK+TNGSDLYRILDQCKVG+KVIVEVLRGD KEKIP Sbjct: 355 GLQSTKRDSYGRLILGDIITSVNDKKVTNGSDLYRILDQCKVGEKVIVEVLRGDHKEKIP 414 Query: 206 VVLEPKPDES 177 V+LEPKPDES Sbjct: 415 VILEPKPDES 424 >ref|XP_006470331.1| PREDICTED: protease Do-like 1, chloroplastic-like [Citrus sinensis] Length = 436 Score = 128 bits (322), Expect = 7e-28 Identities = 62/70 (88%), Positives = 67/70 (95%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GLLSTKRDAYGRL+LGDII SVNGKK++NGSDLYRILDQCKVGD+VIVEVLRGD KEKIP Sbjct: 367 GLLSTKRDAYGRLILGDIIISVNGKKVSNGSDLYRILDQCKVGDEVIVEVLRGDHKEKIP 426 Query: 206 VVLEPKPDES 177 V LEPKPDE+ Sbjct: 427 VKLEPKPDET 436 >gb|EEE64736.1| hypothetical protein OsJ_19592 [Oryza sativa Japonica Group] Length = 437 Score = 128 bits (322), Expect = 7e-28 Identities = 61/70 (87%), Positives = 67/70 (95%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GL STKRD+YGRL+LGDIITSVNG K+TNGSDLYRILDQCKVG+KV VEVLRGD+KEKIP Sbjct: 368 GLQSTKRDSYGRLILGDIITSVNGTKVTNGSDLYRILDQCKVGEKVTVEVLRGDQKEKIP 427 Query: 206 VVLEPKPDES 177 V+LEPKPDES Sbjct: 428 VILEPKPDES 437 >gb|EEC79717.1| hypothetical protein OsI_21033 [Oryza sativa Indica Group] Length = 437 Score = 128 bits (322), Expect = 7e-28 Identities = 61/70 (87%), Positives = 67/70 (95%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GL STKRD+YGRL+LGDIITSVNG K+TNGSDLYRILDQCKVG+KV VEVLRGD+KEKIP Sbjct: 368 GLQSTKRDSYGRLILGDIITSVNGTKVTNGSDLYRILDQCKVGEKVTVEVLRGDQKEKIP 427 Query: 206 VVLEPKPDES 177 V+LEPKPDES Sbjct: 428 VILEPKPDES 437 >ref|NP_001056360.1| Os05g0568900 [Oryza sativa Japonica Group] gi|51038126|gb|AAT93929.1| putative DegP protease [Oryza sativa Japonica Group] gi|51854294|gb|AAU10675.1| putative DegP protease [Oryza sativa Japonica Group] gi|113579911|dbj|BAF18274.1| Os05g0568900 [Oryza sativa Japonica Group] gi|215692515|dbj|BAG87935.1| unnamed protein product [Oryza sativa Japonica Group] gi|215767869|dbj|BAH00098.1| unnamed protein product [Oryza sativa Japonica Group] Length = 437 Score = 128 bits (322), Expect = 7e-28 Identities = 61/70 (87%), Positives = 67/70 (95%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GL STKRD+YGRL+LGDIITSVNG K+TNGSDLYRILDQCKVG+KV VEVLRGD+KEKIP Sbjct: 368 GLQSTKRDSYGRLILGDIITSVNGTKVTNGSDLYRILDQCKVGEKVTVEVLRGDQKEKIP 427 Query: 206 VVLEPKPDES 177 V+LEPKPDES Sbjct: 428 VILEPKPDES 437 >gb|EYU34714.1| hypothetical protein MIMGU_mgv1a006761mg [Mimulus guttatus] Length = 432 Score = 128 bits (321), Expect = 9e-28 Identities = 63/70 (90%), Positives = 66/70 (94%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GL STKRDAYGRLVLGDIITSVNG K++NGSDLYRILDQCKVGD VIVEVLRGDK EKIP Sbjct: 363 GLQSTKRDAYGRLVLGDIITSVNGTKVSNGSDLYRILDQCKVGDNVIVEVLRGDKLEKIP 422 Query: 206 VVLEPKPDES 177 V+LEPKPDES Sbjct: 423 VLLEPKPDES 432 >ref|NP_001242692.1| uncharacterized protein LOC100783304 [Glycine max] gi|255641306|gb|ACU20930.1| unknown [Glycine max] Length = 431 Score = 128 bits (321), Expect = 9e-28 Identities = 62/70 (88%), Positives = 66/70 (94%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GL STKRD+YGR +LGDIITSVN KK+TNGSDLYRILDQCKVGDKVIVEVLRGD KEKIP Sbjct: 362 GLQSTKRDSYGRPILGDIITSVNDKKVTNGSDLYRILDQCKVGDKVIVEVLRGDHKEKIP 421 Query: 206 VVLEPKPDES 177 V+LEPKPDES Sbjct: 422 VILEPKPDES 431 >ref|XP_004232295.1| PREDICTED: protease Do-like 1, chloroplastic-like [Solanum lycopersicum] Length = 430 Score = 127 bits (320), Expect = 1e-27 Identities = 59/70 (84%), Positives = 69/70 (98%) Frame = -1 Query: 386 GLLSTKRDAYGRLVLGDIITSVNGKKITNGSDLYRILDQCKVGDKVIVEVLRGDKKEKIP 207 GLL TKRD+YGRL+LGDIITS+NGKK++NG+DLYRILDQCKVG+KVIVEVLRGD+KEKIP Sbjct: 361 GLLPTKRDSYGRLILGDIITSINGKKVSNGTDLYRILDQCKVGEKVIVEVLRGDQKEKIP 420 Query: 206 VVLEPKPDES 177 V+LEPKP+ES Sbjct: 421 VLLEPKPEES 430