BLASTX nr result
ID: Mentha24_contig00003616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00003616 (717 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004244103.1| PREDICTED: uncharacterized protein LOC101243... 57 6e-06 >ref|XP_004244103.1| PREDICTED: uncharacterized protein LOC101243908 [Solanum lycopersicum] Length = 116 Score = 57.0 bits (136), Expect = 6e-06 Identities = 32/65 (49%), Positives = 40/65 (61%), Gaps = 4/65 (6%) Frame = -1 Query: 510 RALPYPVLLATTVPP-GGKLSVLLQTGGVCLIAYWVANFVVPGIVLKDLQSKA---NEEK 343 R L P L A P G LSVLLQTG V L YW+ANFVVP ++KDLQ ++ N + Sbjct: 51 RNLLIPPLKAVNSPATSGDLSVLLQTGAVMLFIYWIANFVVPEFIMKDLQDESTNNNNKT 110 Query: 342 DEDEL 328 DE ++ Sbjct: 111 DEKDI 115