BLASTX nr result
ID: Mentha24_contig00003612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00003612 (620 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007013620.1| Aldose 1-epimerase [Theobroma cacao] gi|5087... 57 6e-06 >ref|XP_007013620.1| Aldose 1-epimerase [Theobroma cacao] gi|508783983|gb|EOY31239.1| Aldose 1-epimerase [Theobroma cacao] Length = 169 Score = 56.6 bits (135), Expect = 6e-06 Identities = 30/72 (41%), Positives = 46/72 (63%), Gaps = 4/72 (5%) Frame = -2 Query: 478 MEVAKLSSDAKQLALCSFVEAAVVNSLLAAQNSITCLLMLTSSLLNDELPDW----IEKR 311 MEV +LS K + +CS +EA V +L+ A NS+ CLLMLT S+L D +++R Sbjct: 1 MEVGRLSPVEKSIWVCSVMEALVAETLVLAGNSLACLLMLTESVLKDMNASHGLTAVDER 60 Query: 310 FPMEELHRVEKP 275 FP +EL ++++P Sbjct: 61 FPYDELLKMKRP 72