BLASTX nr result
ID: Mentha24_contig00003452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00003452 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT36331.1| nitrilase 4A [Lupinus angustifolius] gi|79082433|... 56 5e-06 >gb|AAT36331.1| nitrilase 4A [Lupinus angustifolius] gi|79082433|gb|ABB51979.1| nitrilase 4A [Lupinus angustifolius] Length = 349 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 313 VVGHYARPEILSLVVKDHPMPPVSFSSASTK 221 VVGHY+RPE+LSLVVKDHP PV+F+SASTK Sbjct: 313 VVGHYSRPEVLSLVVKDHPTNPVTFTSASTK 343