BLASTX nr result
ID: Mentha24_contig00003443
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00003443 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26733.1| hypothetical protein MIMGU_mgv1a009205mg [Mimulus... 59 9e-07 ref|XP_006481512.1| PREDICTED: bifunctional nitrilase/nitrile hy... 57 3e-06 ref|XP_006424151.1| hypothetical protein CICLE_v10028755mg [Citr... 57 3e-06 ref|XP_006424150.1| hypothetical protein CICLE_v10028755mg [Citr... 57 3e-06 ref|XP_004291690.1| PREDICTED: bifunctional nitrilase/nitrile hy... 57 3e-06 >gb|EYU26733.1| hypothetical protein MIMGU_mgv1a009205mg [Mimulus guttatus] Length = 349 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 398 VVGHYARPEILSLVVKDHPMPPVSFSSASAKPESPKR 288 VVGHYARPE+LSLVVKD+PM P SF+SAS K ES ++ Sbjct: 313 VVGHYARPEVLSLVVKDNPMTPFSFTSASVKAESSQK 349 >ref|XP_006481512.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4A-like [Citrus sinensis] Length = 345 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 398 VVGHYARPEILSLVVKDHPMPPVSFSSASAKPE 300 VVGHY+RPE+LSLVV+DHP PV+F+SASAK E Sbjct: 309 VVGHYSRPEVLSLVVRDHPATPVTFTSASAKTE 341 >ref|XP_006424151.1| hypothetical protein CICLE_v10028755mg [Citrus clementina] gi|557526085|gb|ESR37391.1| hypothetical protein CICLE_v10028755mg [Citrus clementina] Length = 320 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 398 VVGHYARPEILSLVVKDHPMPPVSFSSASAKPE 300 VVGHY+RPE+LSLVV+DHP PV+F+SASAK E Sbjct: 284 VVGHYSRPEVLSLVVRDHPATPVTFTSASAKTE 316 >ref|XP_006424150.1| hypothetical protein CICLE_v10028755mg [Citrus clementina] gi|557526084|gb|ESR37390.1| hypothetical protein CICLE_v10028755mg [Citrus clementina] Length = 345 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 398 VVGHYARPEILSLVVKDHPMPPVSFSSASAKPE 300 VVGHY+RPE+LSLVV+DHP PV+F+SASAK E Sbjct: 309 VVGHYSRPEVLSLVVRDHPATPVTFTSASAKTE 341 >ref|XP_004291690.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4B-like [Fragaria vesca subsp. vesca] Length = 364 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 398 VVGHYARPEILSLVVKDHPMPPVSFSSASAKPE 300 VVGHYARPE+LSL+V+DHP PV+F+SASAK E Sbjct: 327 VVGHYARPEVLSLIVRDHPANPVTFTSASAKNE 359