BLASTX nr result
ID: Mentha24_contig00003218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00003218 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007052409.1| Ribosomal protein S11-beta isoform 2 [Theobr... 68 2e-09 ref|XP_006284663.1| hypothetical protein CARUB_v10005922mg [Caps... 68 2e-09 ref|XP_006404910.1| hypothetical protein EUTSA_v100004070mg [Eut... 67 3e-09 ref|XP_004241368.1| PREDICTED: 40S ribosomal protein S11-like [S... 67 3e-09 ref|XP_002880547.1| ribosomal protein S11-beta [Arabidopsis lyra... 67 3e-09 ref|NP_194809.1| 40S ribosomal protein S11-2 [Arabidopsis thalia... 66 4e-09 ref|XP_002869362.1| 40S ribosomal protein S11 [Arabidopsis lyrat... 66 4e-09 ref|XP_002532505.1| 40S ribosomal protein S11, putative [Ricinus... 66 4e-09 gb|EPS63567.1| hypothetical protein M569_11218, partial [Genlise... 66 6e-09 ref|XP_007052408.1| Ribosomal protein S11-beta isoform 1 [Theobr... 66 6e-09 ref|XP_006349147.1| PREDICTED: 40S ribosomal protein S11-like [S... 65 1e-08 ref|XP_007013672.1| Ribosomal protein S11-beta [Theobroma cacao]... 65 1e-08 ref|XP_007011791.1| Ribosomal protein S11-beta [Theobroma cacao]... 65 1e-08 ref|XP_006296532.1| hypothetical protein CARUB_v10025724mg [Caps... 65 1e-08 ref|XP_004252282.1| PREDICTED: 40S ribosomal protein S11-like [S... 65 1e-08 ref|XP_004144894.1| PREDICTED: 40S ribosomal protein S11-3-like ... 65 1e-08 gb|AFX66997.1| 40s ribosomal protein S11 [Solanum tuberosum] 65 1e-08 ref|XP_006404202.1| hypothetical protein EUTSA_v10010781mg [Eutr... 64 2e-08 ref|XP_006394638.1| hypothetical protein EUTSA_v10005057mg [Eutr... 64 2e-08 ref|XP_007223638.1| hypothetical protein PRUPE_ppa012659mg [Prun... 64 2e-08 >ref|XP_007052409.1| Ribosomal protein S11-beta isoform 2 [Theobroma cacao] gi|508704670|gb|EOX96566.1| Ribosomal protein S11-beta isoform 2 [Theobroma cacao] Length = 159 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGSSG GKKAFAGM Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFAGM 159 >ref|XP_006284663.1| hypothetical protein CARUB_v10005922mg [Capsella rubella] gi|482553368|gb|EOA17561.1| hypothetical protein CARUB_v10005922mg [Capsella rubella] Length = 159 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGSS +GKKAFAGM Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGSSAIGKKAFAGM 159 >ref|XP_006404910.1| hypothetical protein EUTSA_v100004070mg [Eutrema salsugineum] gi|557106038|gb|ESQ46363.1| hypothetical protein EUTSA_v100004070mg [Eutrema salsugineum] Length = 79 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGSS +GKKAF+GM Sbjct: 46 IGQCRPLSKTVRFNVLKVIPAGSSAIGKKAFSGM 79 >ref|XP_004241368.1| PREDICTED: 40S ribosomal protein S11-like [Solanum lycopersicum] gi|460391521|ref|XP_004241369.1| PREDICTED: 40S ribosomal protein S11-like [Solanum lycopersicum] Length = 159 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGS G+GKKAF GM Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGSGGVGKKAFTGM 159 >ref|XP_002880547.1| ribosomal protein S11-beta [Arabidopsis lyrata subsp. lyrata] gi|297326386|gb|EFH56806.1| ribosomal protein S11-beta [Arabidopsis lyrata subsp. lyrata] Length = 159 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGSS +GKKAF+GM Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGSSAIGKKAFSGM 159 >ref|NP_194809.1| 40S ribosomal protein S11-2 [Arabidopsis thaliana] gi|11134432|sp|O65569.2|RS112_ARATH RecName: Full=40S ribosomal protein S11-2 gi|5708091|emb|CAA18213.2| ribosomal protein S11-like [Arabidopsis thaliana] gi|7269981|emb|CAB79798.1| ribosomal protein S11-like [Arabidopsis thaliana] gi|15028245|gb|AAK76711.1| putative ribosomal protein S11 [Arabidopsis thaliana] gi|20258899|gb|AAM14143.1| putative ribosomal protein S11 [Arabidopsis thaliana] gi|332660410|gb|AEE85810.1| 40S ribosomal protein S11-2 [Arabidopsis thaliana] Length = 159 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGSS +GKKAF GM Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGSSSIGKKAFTGM 159 >ref|XP_002869362.1| 40S ribosomal protein S11 [Arabidopsis lyrata subsp. lyrata] gi|297315198|gb|EFH45621.1| 40S ribosomal protein S11 [Arabidopsis lyrata subsp. lyrata] Length = 159 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGSS +GKKAF GM Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGSSSIGKKAFTGM 159 >ref|XP_002532505.1| 40S ribosomal protein S11, putative [Ricinus communis] gi|223527780|gb|EEF29881.1| 40S ribosomal protein S11, putative [Ricinus communis] Length = 159 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGSSG GKKAF GM Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFTGM 159 >gb|EPS63567.1| hypothetical protein M569_11218, partial [Genlisea aurea] Length = 62 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGSSG GKKAF G+ Sbjct: 29 IGQCRPLSKTVRFNVLKVIPAGSSGRGKKAFTGL 62 >ref|XP_007052408.1| Ribosomal protein S11-beta isoform 1 [Theobroma cacao] gi|508704669|gb|EOX96565.1| Ribosomal protein S11-beta isoform 1 [Theobroma cacao] Length = 186 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAG 101 IGQCRPLSKTVRFNVLKVIPAGSSG GKKAFAG Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFAG 158 >ref|XP_006349147.1| PREDICTED: 40S ribosomal protein S11-like [Solanum tuberosum] Length = 159 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGS G GKKAF GM Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGSGGGGKKAFTGM 159 >ref|XP_007013672.1| Ribosomal protein S11-beta [Theobroma cacao] gi|508784035|gb|EOY31291.1| Ribosomal protein S11-beta [Theobroma cacao] Length = 159 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGSSG GKKAF G+ Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 159 >ref|XP_007011791.1| Ribosomal protein S11-beta [Theobroma cacao] gi|508782154|gb|EOY29410.1| Ribosomal protein S11-beta [Theobroma cacao] Length = 192 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGSSG GKKAF G+ Sbjct: 159 IGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 192 >ref|XP_006296532.1| hypothetical protein CARUB_v10025724mg [Capsella rubella] gi|482565240|gb|EOA29430.1| hypothetical protein CARUB_v10025724mg [Capsella rubella] Length = 159 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGSS +GKKAF G+ Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGSSAIGKKAFTGV 159 >ref|XP_004252282.1| PREDICTED: 40S ribosomal protein S11-like [Solanum lycopersicum] gi|565359701|ref|XP_006346633.1| PREDICTED: 40S ribosomal protein S11-like [Solanum tuberosum] gi|565359703|ref|XP_006346634.1| PREDICTED: 40S ribosomal protein S11-like [Solanum tuberosum] gi|565390794|ref|XP_006361120.1| PREDICTED: 40S ribosomal protein S11-like [Solanum tuberosum] Length = 159 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGS G GKKAF GM Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGSGGGGKKAFTGM 159 >ref|XP_004144894.1| PREDICTED: 40S ribosomal protein S11-3-like [Cucumis sativus] gi|449471994|ref|XP_004153463.1| PREDICTED: 40S ribosomal protein S11-3-like [Cucumis sativus] gi|449522568|ref|XP_004168298.1| PREDICTED: 40S ribosomal protein S11-3-like [Cucumis sativus] Length = 159 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGSS GKKAFAG+ Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGSSSRGKKAFAGI 159 >gb|AFX66997.1| 40s ribosomal protein S11 [Solanum tuberosum] Length = 159 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAGS G GKKAF GM Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGSGGGGKKAFTGM 159 >ref|XP_006404202.1| hypothetical protein EUTSA_v10010781mg [Eutrema salsugineum] gi|557105321|gb|ESQ45655.1| hypothetical protein EUTSA_v10010781mg [Eutrema salsugineum] Length = 159 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAG+S GKKAF GM Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGASAFGKKAFTGM 159 >ref|XP_006394638.1| hypothetical protein EUTSA_v10005057mg [Eutrema salsugineum] gi|557091277|gb|ESQ31924.1| hypothetical protein EUTSA_v10005057mg [Eutrema salsugineum] Length = 159 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKVIPAG+S GKKAF GM Sbjct: 126 IGQCRPLSKTVRFNVLKVIPAGASAFGKKAFTGM 159 >ref|XP_007223638.1| hypothetical protein PRUPE_ppa012659mg [Prunus persica] gi|462420574|gb|EMJ24837.1| hypothetical protein PRUPE_ppa012659mg [Prunus persica] Length = 159 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 3 IGQCRPLSKTVRFNVLKVIPAGSSGLGKKAFAGM 104 IGQCRPLSKTVRFNVLKV PAGSSG GKKAF G+ Sbjct: 126 IGQCRPLSKTVRFNVLKVTPAGSSGAGKKAFTGI 159