BLASTX nr result
ID: Mentha24_contig00003203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00003203 (521 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004241643.1| PREDICTED: calnexin homolog 1-like [Solanum ... 69 5e-10 ref|XP_006366282.1| PREDICTED: calnexin homolog [Solanum tuberosum] 67 3e-09 ref|NP_001234129.1| calnexin-like protein precursor [Solanum lyc... 64 2e-08 ref|XP_006341454.1| PREDICTED: calnexin homolog [Solanum tuberosum] 63 5e-08 >ref|XP_004241643.1| PREDICTED: calnexin homolog 1-like [Solanum lycopersicum] Length = 538 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/51 (66%), Positives = 38/51 (74%) Frame = -1 Query: 155 MECPNRRIWILQCLLLFSAACFISQLYASDDVIFYESFDEDFEGRWIASEK 3 ME NRR+W LLL A CF+SQLYAS DV FYESFDE F+GRWI S+K Sbjct: 1 MEERNRRMWTQYALLLL-AGCFVSQLYASSDVKFYESFDETFDGRWIVSQK 50 >ref|XP_006366282.1| PREDICTED: calnexin homolog [Solanum tuberosum] Length = 538 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = -1 Query: 155 MECPNRRIWILQCLLLFSAACFISQLYASDDVIFYESFDEDFEGRWIASEK 3 ME NRR+W LLL A CF+SQL AS DV FYESFDE F+GRWI SEK Sbjct: 1 MEERNRRMWTQYALLLL-AGCFVSQLCASSDVKFYESFDEAFDGRWIVSEK 50 >ref|NP_001234129.1| calnexin-like protein precursor [Solanum lycopersicum] gi|67077850|dbj|BAD99512.1| calnexin-like protein [Solanum lycopersicum] Length = 538 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = -1 Query: 155 MECPNRRIWILQCLLLFSAACFISQLYASDDVIFYESFDEDFEGRWIASEK 3 ME R+IW LL A CF SQLYA+ DV FYESFDE F+GRWI SEK Sbjct: 1 MEETRRKIWAQYAFLLL-ACCFFSQLYATSDVKFYESFDEAFDGRWIVSEK 50 >ref|XP_006341454.1| PREDICTED: calnexin homolog [Solanum tuberosum] Length = 541 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -1 Query: 155 MECPNRRIWILQCLLLFSAACFISQLYASDDVIFYESFDEDFEGRWIASEK 3 ME R+IW LL A CF SQLYA+ DV F+ESFDE F+GRWI SEK Sbjct: 1 MEETRRKIWAQYAFLLL-ACCFFSQLYATSDVKFFESFDEAFDGRWIVSEK 50