BLASTX nr result
ID: Mentha24_contig00002341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00002341 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20394.1| hypothetical protein MIMGU_mgv1a000210mg [Mimulus... 74 2e-11 ref|XP_006355304.1| PREDICTED: uncharacterized protein LOC102598... 71 1e-10 ref|XP_004245131.1| PREDICTED: uncharacterized protein LOC101243... 70 3e-10 gb|EPS64424.1| hypothetical protein M569_10357 [Genlisea aurea] 70 4e-10 ref|XP_006283000.1| hypothetical protein CARUB_v10003989mg [Caps... 69 7e-10 ref|XP_007225467.1| hypothetical protein PRUPE_ppa000219mg [Prun... 68 2e-09 ref|XP_006412410.1| hypothetical protein EUTSA_v10024217mg [Eutr... 67 2e-09 gb|AAL15264.1| AT4g32920/F26P21_40 [Arabidopsis thaliana] gi|250... 67 2e-09 ref|NP_567910.1| glycine-rich protein [Arabidopsis thaliana] gi|... 67 2e-09 dbj|BAE99045.1| hypothetical protein [Arabidopsis thaliana] 67 2e-09 ref|XP_002516490.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 ref|XP_006581468.1| PREDICTED: uncharacterized protein LOC100804... 66 4e-09 ref|XP_007012217.1| Uncharacterized protein isoform 1 [Theobroma... 66 4e-09 ref|XP_002278525.2| PREDICTED: uncharacterized protein LOC100243... 66 4e-09 ref|XP_003523758.1| PREDICTED: uncharacterized protein LOC100783... 66 4e-09 ref|XP_002867220.1| glycine-rich protein [Arabidopsis lyrata sub... 66 4e-09 emb|CBI20602.3| unnamed protein product [Vitis vinifera] 66 4e-09 ref|XP_002308587.2| hypothetical protein POPTR_0006s25110g [Popu... 66 6e-09 ref|XP_006475982.1| PREDICTED: uncharacterized protein LOC102616... 65 7e-09 ref|XP_006475981.1| PREDICTED: uncharacterized protein LOC102616... 65 7e-09 >gb|EYU20394.1| hypothetical protein MIMGU_mgv1a000210mg [Mimulus guttatus] Length = 1430 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -1 Query: 333 ALLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 AL+LCKCIQSKLVNWHVANLEIQDRSLYS+D D FW S Sbjct: 1393 ALVLCKCIQSKLVNWHVANLEIQDRSLYSNDFDSFWQS 1430 >ref|XP_006355304.1| PREDICTED: uncharacterized protein LOC102598748 [Solanum tuberosum] Length = 1439 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 333 ALLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 AL+LCKCIQ +LVNWHVANLEIQDRSLYS+D +LFW S Sbjct: 1402 ALVLCKCIQLQLVNWHVANLEIQDRSLYSNDFELFWQS 1439 >ref|XP_004245131.1| PREDICTED: uncharacterized protein LOC101243915 [Solanum lycopersicum] Length = 1439 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 333 ALLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 AL+LCKCIQ +L+NWHVANLEIQDRSLYS+D +LFW S Sbjct: 1402 ALVLCKCIQLQLLNWHVANLEIQDRSLYSNDFELFWQS 1439 >gb|EPS64424.1| hypothetical protein M569_10357 [Genlisea aurea] Length = 1430 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -1 Query: 333 ALLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 AL++CK IQSKLVN+HVANLEIQDRSLYS+D D+FWHS Sbjct: 1393 ALVICKSIQSKLVNFHVANLEIQDRSLYSNDSDIFWHS 1430 >ref|XP_006283000.1| hypothetical protein CARUB_v10003989mg [Capsella rubella] gi|482551705|gb|EOA15898.1| hypothetical protein CARUB_v10003989mg [Capsella rubella] Length = 1434 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -1 Query: 336 LALLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 +AL LCK +QS+LVNWHVANLEIQD SLYSDD DLFW S Sbjct: 1396 VALFLCKVLQSQLVNWHVANLEIQDYSLYSDDSDLFWQS 1434 >ref|XP_007225467.1| hypothetical protein PRUPE_ppa000219mg [Prunus persica] gi|462422403|gb|EMJ26666.1| hypothetical protein PRUPE_ppa000219mg [Prunus persica] Length = 1446 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 330 LLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 LLLCK QS+L+NWHVANLEIQDRSLYS+D++LFW S Sbjct: 1410 LLLCKIFQSQLINWHVANLEIQDRSLYSNDVELFWQS 1446 >ref|XP_006412410.1| hypothetical protein EUTSA_v10024217mg [Eutrema salsugineum] gi|557113580|gb|ESQ53863.1| hypothetical protein EUTSA_v10024217mg [Eutrema salsugineum] Length = 1436 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 336 LALLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 +AL LCK +QS+LVNWHVANLEIQD SLYSDD +LFW S Sbjct: 1398 VALFLCKVLQSQLVNWHVANLEIQDYSLYSDDSELFWQS 1436 >gb|AAL15264.1| AT4g32920/F26P21_40 [Arabidopsis thaliana] gi|25090274|gb|AAN72267.1| At4g32920/F26P21_40 [Arabidopsis thaliana] Length = 346 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 336 LALLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 +AL LCK +QS+LVNWHVANLEIQD SLYSDD +LFW S Sbjct: 308 VALFLCKVLQSQLVNWHVANLEIQDYSLYSDDSELFWQS 346 >ref|NP_567910.1| glycine-rich protein [Arabidopsis thaliana] gi|334187105|ref|NP_001190893.1| glycine-rich protein [Arabidopsis thaliana] gi|334187107|ref|NP_001190894.1| glycine-rich protein [Arabidopsis thaliana] gi|332660744|gb|AEE86144.1| glycine-rich protein [Arabidopsis thaliana] gi|332660745|gb|AEE86145.1| glycine-rich protein [Arabidopsis thaliana] gi|332660746|gb|AEE86146.1| glycine-rich protein [Arabidopsis thaliana] Length = 1432 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 336 LALLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 +AL LCK +QS+LVNWHVANLEIQD SLYSDD +LFW S Sbjct: 1394 VALFLCKVLQSQLVNWHVANLEIQDYSLYSDDSELFWQS 1432 >dbj|BAE99045.1| hypothetical protein [Arabidopsis thaliana] Length = 687 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 336 LALLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 +AL LCK +QS+LVNWHVANLEIQD SLYSDD +LFW S Sbjct: 649 VALFLCKVLQSQLVNWHVANLEIQDYSLYSDDSELFWQS 687 >ref|XP_002516490.1| conserved hypothetical protein [Ricinus communis] gi|223544310|gb|EEF45831.1| conserved hypothetical protein [Ricinus communis] Length = 1426 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 330 LLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 L+LCK +QS+LVNWHVANLEIQDRSLYS D +LFW S Sbjct: 1390 LVLCKILQSQLVNWHVANLEIQDRSLYSSDFELFWQS 1426 >ref|XP_006581468.1| PREDICTED: uncharacterized protein LOC100804207 [Glycine max] Length = 1447 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -1 Query: 330 LLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 L+LCK QS+L+NWHVANLEIQDRSLYS+D +LFW S Sbjct: 1411 LVLCKLFQSQLINWHVANLEIQDRSLYSNDFELFWQS 1447 >ref|XP_007012217.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508782580|gb|EOY29836.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 1452 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -1 Query: 330 LLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 L+LCK QS+L+NWHVANLEIQDRSLYS+D +LFW S Sbjct: 1416 LVLCKLFQSQLINWHVANLEIQDRSLYSNDFELFWQS 1452 >ref|XP_002278525.2| PREDICTED: uncharacterized protein LOC100243932 [Vitis vinifera] Length = 1416 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = -1 Query: 330 LLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 L++CK IQS+L+NWH+ANLEIQDRSLYS+D +LFW S Sbjct: 1380 LVVCKFIQSRLINWHIANLEIQDRSLYSNDFELFWQS 1416 >ref|XP_003523758.1| PREDICTED: uncharacterized protein LOC100783686 [Glycine max] Length = 1447 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -1 Query: 330 LLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 L+LCK QS+L+NWHVANLEIQDRSLYS+D +LFW S Sbjct: 1411 LVLCKLFQSQLINWHVANLEIQDRSLYSNDFELFWQS 1447 >ref|XP_002867220.1| glycine-rich protein [Arabidopsis lyrata subsp. lyrata] gi|297313056|gb|EFH43479.1| glycine-rich protein [Arabidopsis lyrata subsp. lyrata] Length = 1424 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 336 LALLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 +AL LCK +QS+LVNWHVANLEIQD SLYSDD ++FW S Sbjct: 1386 VALFLCKVLQSQLVNWHVANLEIQDYSLYSDDSEVFWQS 1424 >emb|CBI20602.3| unnamed protein product [Vitis vinifera] Length = 1439 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = -1 Query: 330 LLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 L++CK IQS+L+NWH+ANLEIQDRSLYS+D +LFW S Sbjct: 1403 LVVCKFIQSRLINWHIANLEIQDRSLYSNDFELFWQS 1439 >ref|XP_002308587.2| hypothetical protein POPTR_0006s25110g [Populus trichocarpa] gi|550337045|gb|EEE92110.2| hypothetical protein POPTR_0006s25110g [Populus trichocarpa] Length = 1412 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = -1 Query: 330 LLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 L++CK +QS+L+NWHVANLEIQDRSLYS+D +LFW S Sbjct: 1376 LVVCKILQSQLINWHVANLEIQDRSLYSNDFELFWQS 1412 >ref|XP_006475982.1| PREDICTED: uncharacterized protein LOC102616975 isoform X2 [Citrus sinensis] Length = 1428 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -1 Query: 330 LLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 L+LCK QS+LVNWHVANLEIQDR+LYS+D +LFW S Sbjct: 1392 LVLCKIFQSQLVNWHVANLEIQDRTLYSNDFELFWQS 1428 >ref|XP_006475981.1| PREDICTED: uncharacterized protein LOC102616975 isoform X1 [Citrus sinensis] Length = 1458 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -1 Query: 330 LLLCKCIQSKLVNWHVANLEIQDRSLYSDDLDLFWHS 220 L+LCK QS+LVNWHVANLEIQDR+LYS+D +LFW S Sbjct: 1422 LVLCKIFQSQLVNWHVANLEIQDRTLYSNDFELFWQS 1458