BLASTX nr result
ID: Mentha24_contig00000955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00000955 (661 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25019.1| hypothetical protein MIMGU_mgv1a016902mg [Mimulus... 79 9e-26 gb|EPS66502.1| hypothetical protein M569_08279 [Genlisea aurea] 76 5e-23 ref|XP_007152388.1| hypothetical protein PHAVU_004G125800g [Phas... 77 3e-22 emb|CBI24493.3| unnamed protein product [Vitis vinifera] 77 4e-22 ref|XP_002269624.1| PREDICTED: CDGSH iron-sulfur domain-containi... 77 4e-22 gb|EXC20884.1| CDGSH iron-sulfur domain-containing protein 2A [M... 77 6e-22 ref|XP_002321854.2| hypothetical protein POPTR_0015s14240g [Popu... 77 7e-22 ref|XP_007218597.1| hypothetical protein PRUPE_ppa013339mg [Prun... 77 7e-22 ref|XP_003548239.1| PREDICTED: CDGSH iron-sulfur domain-containi... 77 7e-22 ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycin... 77 7e-22 ref|XP_002318867.1| hypothetical protein POPTR_0012s14230g [Popu... 77 7e-22 gb|AFK46198.1| unknown [Lotus japonicus] 77 9e-22 ref|XP_006421772.1| hypothetical protein CICLE_v10006560mg, part... 77 4e-21 ref|XP_006490265.1| PREDICTED: CDGSH iron-sulfur domain-containi... 77 5e-21 ref|XP_004506290.1| PREDICTED: CDGSH iron-sulfur domain-containi... 76 8e-21 ref|XP_004308153.1| PREDICTED: CDGSH iron-sulfur domain-containi... 75 8e-21 ref|XP_006348049.1| PREDICTED: CDGSH iron-sulfur domain-containi... 75 1e-20 ref|XP_004234151.1| PREDICTED: CDGSH iron-sulfur domain-containi... 75 1e-20 ref|XP_004143713.1| PREDICTED: CDGSH iron-sulfur domain-containi... 77 3e-20 ref|XP_002510894.1| conserved hypothetical protein [Ricinus comm... 77 3e-20 >gb|EYU25019.1| hypothetical protein MIMGU_mgv1a016902mg [Mimulus guttatus] Length = 102 Score = 79.3 bits (194), Expect(2) = 9e-26 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLKN 405 CRCWRSGTFPLCDG HVKHNKATGDN+GPLLLKN Sbjct: 68 CRCWRSGTFPLCDGSHVKHNKATGDNIGPLLLKN 101 Score = 64.3 bits (155), Expect(2) = 9e-26 Identities = 36/68 (52%), Positives = 43/68 (63%), Gaps = 6/68 (8%) Frame = +2 Query: 116 MASL-FCNAYAALSYG-----GXXXXXXXXXXXXXXXEAINPDIRKSEEKVVDSVVLSEI 277 MASL CN YA +SYG EAINPDIRK+E+KVVDSVV++E+ Sbjct: 1 MASLSICNVYAGISYGIRPASSGGAAAKPRRMVAVRAEAINPDIRKTEDKVVDSVVVTEL 60 Query: 278 AKPVTAYC 301 AKP+TAYC Sbjct: 61 AKPLTAYC 68 >gb|EPS66502.1| hypothetical protein M569_08279 [Genlisea aurea] Length = 99 Score = 75.9 bits (185), Expect(2) = 5e-23 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNK TGDNVGPLLLK Sbjct: 65 CRCWRSGTFPLCDGSHVKHNKGTGDNVGPLLLK 97 Score = 58.5 bits (140), Expect(2) = 5e-23 Identities = 33/65 (50%), Positives = 39/65 (60%), Gaps = 3/65 (4%) Frame = +2 Query: 116 MASLFCNAYAALSYG---GXXXXXXXXXXXXXXXEAINPDIRKSEEKVVDSVVLSEIAKP 286 MASL C A + +G E+INPDIRKSEEKVVDSVV++E+ KP Sbjct: 1 MASLSCVAVGKVPHGVASSFLHAAPKRRTVAVRAESINPDIRKSEEKVVDSVVVAELGKP 60 Query: 287 VTAYC 301 VTAYC Sbjct: 61 VTAYC 65 >ref|XP_007152388.1| hypothetical protein PHAVU_004G125800g [Phaseolus vulgaris] gi|561025697|gb|ESW24382.1| hypothetical protein PHAVU_004G125800g [Phaseolus vulgaris] Length = 111 Score = 77.4 bits (189), Expect(2) = 3e-22 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKATGDNVGPLLLK Sbjct: 78 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLK 110 Score = 54.3 bits (129), Expect(2) = 3e-22 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +2 Query: 212 AINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 +INPDIRKSEEKVVDSVV++E++KPV AYC Sbjct: 49 SINPDIRKSEEKVVDSVVVTELSKPVNAYC 78 >emb|CBI24493.3| unnamed protein product [Vitis vinifera] Length = 97 Score = 77.4 bits (189), Expect(2) = 4e-22 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKATGDNVGPLLLK Sbjct: 64 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLK 96 Score = 53.9 bits (128), Expect(2) = 4e-22 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 209 EAINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 E INP+IRK EEKVVDSV+++E+AKPVTAYC Sbjct: 34 ETINPEIRKIEEKVVDSVLVAELAKPVTAYC 64 >ref|XP_002269624.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Vitis vinifera] Length = 117 Score = 77.4 bits (189), Expect(2) = 4e-22 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKATGDNVGPLLLK Sbjct: 84 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLK 116 Score = 53.9 bits (128), Expect(2) = 4e-22 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 209 EAINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 E INP+IRK EEKVVDSV+++E+AKPVTAYC Sbjct: 54 ETINPEIRKIEEKVVDSVLVAELAKPVTAYC 84 >gb|EXC20884.1| CDGSH iron-sulfur domain-containing protein 2A [Morus notabilis] Length = 117 Score = 77.4 bits (189), Expect(2) = 6e-22 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKATGDNVGPLLLK Sbjct: 83 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLK 115 Score = 53.5 bits (127), Expect(2) = 6e-22 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +2 Query: 209 EAINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 +AINP+IRKSEEKVVDSVV++E++KP+T YC Sbjct: 53 QAINPEIRKSEEKVVDSVVVTELSKPLTPYC 83 >ref|XP_002321854.2| hypothetical protein POPTR_0015s14240g [Populus trichocarpa] gi|550322696|gb|EEF05981.2| hypothetical protein POPTR_0015s14240g [Populus trichocarpa] Length = 173 Score = 77.4 bits (189), Expect(2) = 7e-22 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKATGDNVGPLLLK Sbjct: 137 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLK 169 Score = 53.1 bits (126), Expect(2) = 7e-22 Identities = 22/31 (70%), Positives = 31/31 (100%) Frame = +2 Query: 209 EAINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 ++INP+IRK+EEKVVDSVV++E++KP+TAYC Sbjct: 107 QSINPEIRKNEEKVVDSVVVAELSKPLTAYC 137 >ref|XP_007218597.1| hypothetical protein PRUPE_ppa013339mg [Prunus persica] gi|462415059|gb|EMJ19796.1| hypothetical protein PRUPE_ppa013339mg [Prunus persica] Length = 128 Score = 77.4 bits (189), Expect(2) = 7e-22 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKATGDNVGPLLLK Sbjct: 94 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLK 126 Score = 53.1 bits (126), Expect(2) = 7e-22 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +2 Query: 209 EAINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 + INP+IRKSEEKVVDSVV+SE++KP+T YC Sbjct: 64 QPINPEIRKSEEKVVDSVVVSELSKPLTVYC 94 >ref|XP_003548239.1| PREDICTED: CDGSH iron-sulfur domain-containing protein NEET-like [Glycine max] Length = 113 Score = 77.4 bits (189), Expect(2) = 7e-22 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKATGDNVGPLLLK Sbjct: 80 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLK 112 Score = 53.1 bits (126), Expect(2) = 7e-22 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 212 AINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 +INPDIRKSEEKVVDSVV++E++KP+T YC Sbjct: 51 SINPDIRKSEEKVVDSVVVTELSKPLTPYC 80 >ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycine max] gi|255628565|gb|ACU14627.1| unknown [Glycine max] Length = 113 Score = 77.4 bits (189), Expect(2) = 7e-22 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKATGDNVGPLLLK Sbjct: 80 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLK 112 Score = 53.1 bits (126), Expect(2) = 7e-22 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 212 AINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 +INPDIRKSEEKVVDSVV++E++KP+T YC Sbjct: 51 SINPDIRKSEEKVVDSVVVTELSKPLTPYC 80 >ref|XP_002318867.1| hypothetical protein POPTR_0012s14230g [Populus trichocarpa] gi|222859540|gb|EEE97087.1| hypothetical protein POPTR_0012s14230g [Populus trichocarpa] Length = 107 Score = 77.4 bits (189), Expect(2) = 7e-22 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKATGDNVGPLLLK Sbjct: 71 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLK 103 Score = 53.1 bits (126), Expect(2) = 7e-22 Identities = 22/31 (70%), Positives = 31/31 (100%) Frame = +2 Query: 209 EAINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 +AINP+IRK+EEKVVDSV+++E++KP+TAYC Sbjct: 41 QAINPEIRKTEEKVVDSVMVAELSKPLTAYC 71 >gb|AFK46198.1| unknown [Lotus japonicus] Length = 118 Score = 77.4 bits (189), Expect(2) = 9e-22 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKATGDNVGPLLLK Sbjct: 85 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLK 117 Score = 52.8 bits (125), Expect(2) = 9e-22 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +2 Query: 215 INPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 INPDIRK+E KVVDSVV++E+AKP+TAYC Sbjct: 57 INPDIRKTEAKVVDSVVITELAKPLTAYC 85 >ref|XP_006421772.1| hypothetical protein CICLE_v10006560mg, partial [Citrus clementina] gi|557523645|gb|ESR35012.1| hypothetical protein CICLE_v10006560mg, partial [Citrus clementina] Length = 198 Score = 77.4 bits (189), Expect(2) = 4e-21 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKATGDNVGPLLLK Sbjct: 164 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLK 196 Score = 50.4 bits (119), Expect(2) = 4e-21 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +2 Query: 209 EAINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 + IN DIRK+EEKVVDSVV++E++KP+TAYC Sbjct: 134 QGINLDIRKTEEKVVDSVVVTELSKPLTAYC 164 >ref|XP_006490265.1| PREDICTED: CDGSH iron-sulfur domain-containing protein NEET-like [Citrus sinensis] Length = 130 Score = 77.4 bits (189), Expect(2) = 5e-21 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKATGDNVGPLLLK Sbjct: 96 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLK 128 Score = 50.4 bits (119), Expect(2) = 5e-21 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +2 Query: 209 EAINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 + IN DIRK+EEKVVDSVV++E++KP+TAYC Sbjct: 66 QGINLDIRKTEEKVVDSVVVTELSKPLTAYC 96 >ref|XP_004506290.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2A-like [Cicer arietinum] Length = 122 Score = 76.3 bits (186), Expect(2) = 8e-21 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKATGDNVGPLL+K Sbjct: 89 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLVK 121 Score = 50.8 bits (120), Expect(2) = 8e-21 Identities = 21/30 (70%), Positives = 29/30 (96%) Frame = +2 Query: 212 AINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 +INPDIRK+EEKVVDSV+++E++KP+T YC Sbjct: 60 SINPDIRKNEEKVVDSVLVNELSKPLTPYC 89 >ref|XP_004308153.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2A-like [Fragaria vesca subsp. vesca] Length = 123 Score = 75.5 bits (184), Expect(2) = 8e-21 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKA GDNVGPLLLK Sbjct: 89 CRCWRSGTFPLCDGSHVKHNKAAGDNVGPLLLK 121 Score = 51.6 bits (122), Expect(2) = 8e-21 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +2 Query: 209 EAINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 + +NP+IRKSE KVVDSVV++E+AKP+TAYC Sbjct: 59 QPLNPEIRKSEAKVVDSVVVTELAKPLTAYC 89 >ref|XP_006348049.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Solanum tuberosum] Length = 98 Score = 75.5 bits (184), Expect(2) = 1e-20 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNK TGDNVGPLLLK Sbjct: 64 CRCWRSGTFPLCDGSHVKHNKETGDNVGPLLLK 96 Score = 50.8 bits (120), Expect(2) = 1e-20 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = +2 Query: 209 EAINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 +AINPDI+K E KVVDSV+++E++KP+TAYC Sbjct: 34 QAINPDIKKDEAKVVDSVLVTELSKPLTAYC 64 >ref|XP_004234151.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Solanum lycopersicum] Length = 98 Score = 75.5 bits (184), Expect(2) = 1e-20 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNK TGDNVGPLLLK Sbjct: 64 CRCWRSGTFPLCDGSHVKHNKETGDNVGPLLLK 96 Score = 50.8 bits (120), Expect(2) = 1e-20 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = +2 Query: 209 EAINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 +AINPDI+K E KVVDSV+++E++KP+TAYC Sbjct: 34 QAINPDIKKDEAKVVDSVLVTELSKPLTAYC 64 >ref|XP_004143713.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Cucumis sativus] gi|449506515|ref|XP_004162771.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Cucumis sativus] Length = 108 Score = 77.4 bits (189), Expect(2) = 3e-20 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKATGDNVGPLLLK Sbjct: 75 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLK 107 Score = 47.8 bits (112), Expect(2) = 3e-20 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +2 Query: 209 EAINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 E INP IRKSE+KVVDSV++ E++KP+T YC Sbjct: 45 EHINPAIRKSEDKVVDSVLVPELSKPLTPYC 75 >ref|XP_002510894.1| conserved hypothetical protein [Ricinus communis] gi|223550009|gb|EEF51496.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 77.4 bits (189), Expect(2) = 3e-20 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 304 CRCWRSGTFPLCDGGHVKHNKATGDNVGPLLLK 402 CRCWRSGTFPLCDG HVKHNKATGDNVGPLLLK Sbjct: 75 CRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLK 107 Score = 47.8 bits (112), Expect(2) = 3e-20 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = +2 Query: 209 EAINPDIRKSEEKVVDSVVLSEIAKPVTAYC 301 + INP IRK EEKVVDSV+++E++KP+T YC Sbjct: 45 QGINPAIRKDEEKVVDSVMVAELSKPLTPYC 75