BLASTX nr result
ID: Mentha24_contig00000938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00000938 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45462.1| hypothetical protein MIMGU_mgv1a004651mg [Mimulus... 78 1e-12 gb|EYU38183.1| hypothetical protein MIMGU_mgv1a004749mg [Mimulus... 78 1e-12 emb|CBI26002.3| unnamed protein product [Vitis vinifera] 70 4e-10 ref|XP_002274904.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 gb|AFK48661.1| unknown [Lotus japonicus] 66 6e-09 emb|CAN74604.1| hypothetical protein VITISV_025315 [Vitis vinifera] 65 8e-09 ref|XP_004508090.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_002316075.2| hypothetical protein POPTR_0010s16360g [Popu... 62 8e-08 ref|XP_002519315.1| pentatricopeptide repeat-containing protein,... 62 8e-08 ref|XP_002311357.2| hypothetical protein POPTR_0008s09820g [Popu... 62 1e-07 ref|XP_004229043.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_003550954.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_006600379.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_006337965.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_004252946.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_006349961.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_003577908.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 gb|EXB80291.1| hypothetical protein L484_025147 [Morus notabilis] 59 5e-07 ref|XP_006488749.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_006419256.1| hypothetical protein CICLE_v10004807mg [Citr... 59 7e-07 >gb|EYU45462.1| hypothetical protein MIMGU_mgv1a004651mg [Mimulus guttatus] Length = 516 Score = 78.2 bits (191), Expect = 1e-12 Identities = 43/63 (68%), Positives = 48/63 (76%), Gaps = 2/63 (3%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMI-TKVPNGVDFGETE-DSSVVN 188 KDK C+PDSTTYS+MMDAYRKEGM+DKVYDLEQEM+ M KV G D ETE + V Sbjct: 451 KDKSCQPDSTTYSVMMDAYRKEGMSDKVYDLEQEMQRMNGGKVSKGYDDVETEANDDVSK 510 Query: 187 EVL 179 EVL Sbjct: 511 EVL 513 >gb|EYU38183.1| hypothetical protein MIMGU_mgv1a004749mg [Mimulus guttatus] Length = 512 Score = 78.2 bits (191), Expect = 1e-12 Identities = 43/63 (68%), Positives = 48/63 (76%), Gaps = 2/63 (3%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMI-TKVPNGVDFGETE-DSSVVN 188 KDK C+PDSTTYS+MMDAYRKEGM+DKVYDLEQEM+ M KV G D ETE + V Sbjct: 447 KDKSCQPDSTTYSVMMDAYRKEGMSDKVYDLEQEMQRMNGGKVSKGYDDVETEANDDVSK 506 Query: 187 EVL 179 EVL Sbjct: 507 EVL 509 >emb|CBI26002.3| unnamed protein product [Vitis vinifera] Length = 469 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMITKVPNG 227 KDK C+PDSTTYSIM++AY+KEGM DK+YDLEQE + M+ P G Sbjct: 424 KDKHCQPDSTTYSIMVEAYKKEGMNDKIYDLEQERQRMVADGPKG 468 >ref|XP_002274904.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic [Vitis vinifera] Length = 498 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMITKVPNG 227 KDK C+PDSTTYSIM++AY+KEGM DK+YDLEQE + M+ P G Sbjct: 453 KDKHCQPDSTTYSIMVEAYKKEGMNDKIYDLEQERQRMVADGPKG 497 >gb|AFK48661.1| unknown [Lotus japonicus] Length = 266 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMITKVPNGVDFGETED 203 KD C PD TTY+IM++AYRKEGM DK+Y LEQE K+MIT +G+ + ED Sbjct: 213 KDNQCPPDDTTYTIMIEAYRKEGMNDKIYYLEQEKKTMIT---DGIKVSQPED 262 >emb|CAN74604.1| hypothetical protein VITISV_025315 [Vitis vinifera] Length = 525 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMI 245 KDK C+PDSTTYSIM++AY+KEGM DK+YDLEQE + M+ Sbjct: 453 KDKHCQPDSTTYSIMVEAYKKEGMNDKIYDLEQERQRMM 491 >ref|XP_004508090.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Cicer arietinum] Length = 499 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMIT 242 KD C+PD+TTYSIM+ AYRK+GM+DK+Y LEQE ++MIT Sbjct: 446 KDNQCQPDNTTYSIMVKAYRKQGMSDKIYYLEQEKQTMIT 485 >ref|XP_002316075.2| hypothetical protein POPTR_0010s16360g [Populus trichocarpa] gi|550329937|gb|EEF02246.2| hypothetical protein POPTR_0010s16360g [Populus trichocarpa] Length = 487 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMI 245 KDK C PDS TYSIM++AYRKEGM DK+Y LEQE + MI Sbjct: 443 KDKQCPPDSRTYSIMVEAYRKEGMNDKIYYLEQEKQEMI 481 >ref|XP_002519315.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541630|gb|EEF43179.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 491 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMITKV 236 KD C+PDSTTYSIM++AY++EGM DKVY LEQE + M+ V Sbjct: 439 KDNQCQPDSTTYSIMVEAYKREGMNDKVYYLEQEKQGMVAHV 480 >ref|XP_002311357.2| hypothetical protein POPTR_0008s09820g [Populus trichocarpa] gi|550332748|gb|EEE88724.2| hypothetical protein POPTR_0008s09820g [Populus trichocarpa] Length = 445 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMI 245 KDK C PDS TYSIM++AYRKEGM DK+Y LEQE + MI Sbjct: 400 KDKQCLPDSRTYSIMVEAYRKEGMNDKIYYLEQEKQKMI 438 >ref|XP_004229043.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Solanum lycopersicum] Length = 499 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMITKVPNG 227 KDK C+PD TYS M+DAY+KEGMTDKVYDLEQE + NG Sbjct: 442 KDKQCQPDLMTYSTMIDAYQKEGMTDKVYDLEQEKLLKVAIHSNG 486 >ref|XP_003550954.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Glycine max] Length = 488 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMIT 242 KD C+PD TTY+IM++AYRKEGM DK+Y LEQE ++M+T Sbjct: 435 KDSQCQPDDTTYTIMIEAYRKEGMNDKIYYLEQEKQTMMT 474 >ref|XP_006600379.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Glycine max] Length = 488 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMIT 242 KD C+PD TTY+IM++AYRKEGM DK+Y LEQE ++M+T Sbjct: 435 KDSQCQPDDTTYTIMIEAYRKEGMNDKIYYLEQEKQTMMT 474 >ref|XP_006337965.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Solanum tuberosum] Length = 501 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMI 245 KDK C+PD TYS M++AY+KEGMTDKVYDLEQE M+ Sbjct: 444 KDKQCRPDFMTYSTMINAYQKEGMTDKVYDLEQEKLMMV 482 >ref|XP_004252946.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Solanum lycopersicum] Length = 495 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSM 248 KDK +PD TTY++M +AYRKEGMTDKVYDLEQE + M Sbjct: 441 KDKGFRPDDTTYTVMAEAYRKEGMTDKVYDLEQEKRMM 478 >ref|XP_006349961.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Solanum tuberosum] Length = 495 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSM 248 KDK +PD TTY++M +AYRKEGMTDKVYDLEQE + M Sbjct: 441 KDKGFQPDDTTYTVMAEAYRKEGMTDKVYDLEQEKRMM 478 >ref|XP_003577908.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Brachypodium distachyon] Length = 512 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -3 Query: 349 CKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMIT 242 C PD+TTYSI+++AYRKEGMTDKVYDL+QE S+++ Sbjct: 471 CAPDATTYSILVEAYRKEGMTDKVYDLQQENPSLVS 506 >gb|EXB80291.1| hypothetical protein L484_025147 [Morus notabilis] Length = 509 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSM 248 KDK C P+STTYSIM++AYRKEGM DK+Y LEQE + + Sbjct: 452 KDKKCLPNSTTYSIMVEAYRKEGMNDKIYYLEQERQEL 489 >ref|XP_006488749.1| PREDICTED: pentatricopeptide repeat-containing protein At3g06430, chloroplastic-like [Citrus sinensis] Length = 502 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMITK 239 K+K C+PDS T+SIMM+AY KEGM DKVY LEQE M+++ Sbjct: 453 KEKHCRPDSETFSIMMEAYAKEGMNDKVYALEQEKMQMLSE 493 >ref|XP_006419256.1| hypothetical protein CICLE_v10004807mg [Citrus clementina] gi|557521129|gb|ESR32496.1| hypothetical protein CICLE_v10004807mg [Citrus clementina] Length = 502 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -3 Query: 361 KDKLCKPDSTTYSIMMDAYRKEGMTDKVYDLEQEMKSMITK 239 K+K C+PDS T+SIMM+AY KEGM DKVY LEQE M+++ Sbjct: 453 KEKHCRPDSETFSIMMEAYAKEGMNDKVYALEQEKMQMLSE 493