BLASTX nr result
ID: Mentha24_contig00000732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00000732 (446 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31768.1| hypothetical protein MIMGU_mgv1a011129mg [Mimulus... 62 6e-08 >gb|EYU31768.1| hypothetical protein MIMGU_mgv1a011129mg [Mimulus guttatus] Length = 292 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = -2 Query: 445 HVLSPEVQSAPKLSEWEKSALDFPFSYMDGV-GAGAGALI-GSQ 320 HVLSPEV+S P+L+EWEKSAL+FPF+YMD + GA A AL+ GSQ Sbjct: 228 HVLSPEVESVPRLTEWEKSALEFPFNYMDAMDGAAAAALLMGSQ 271