BLASTX nr result
ID: Mentha24_contig00000365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00000365 (463 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21645.1| hypothetical protein MIMGU_mgv1a010577mg [Mimulus... 68 1e-09 >gb|EYU21645.1| hypothetical protein MIMGU_mgv1a010577mg [Mimulus guttatus] Length = 308 Score = 68.2 bits (165), Expect = 1e-09 Identities = 40/84 (47%), Positives = 46/84 (54%), Gaps = 9/84 (10%) Frame = +3 Query: 237 PILNSWLXXXXXXXXXXXXXXXXXXXXXQLTRTRSFCLSMSSEDGIGRSSPTR------F 398 PILNSWL QLTR RSF L++ SE+G+GRS+PT F Sbjct: 9 PILNSWLHNSTAGSGSGSGSSPESDSLPQLTRARSFSLTVCSEEGLGRSNPTATPTRHVF 68 Query: 399 DSDLKDPTKRS---RLPTGPKPAR 461 DSDLKDP K RLPT PKPA+ Sbjct: 69 DSDLKDPAKPKKGLRLPTSPKPAK 92