BLASTX nr result
ID: Mentha24_contig00000364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00000364 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21645.1| hypothetical protein MIMGU_mgv1a010577mg [Mimulus... 87 3e-15 gb|EPS66873.1| hypothetical protein M569_07905, partial [Genlise... 69 7e-10 gb|EYU24640.1| hypothetical protein MIMGU_mgv1a011374mg [Mimulus... 65 7e-09 >gb|EYU21645.1| hypothetical protein MIMGU_mgv1a010577mg [Mimulus guttatus] Length = 308 Score = 86.7 bits (213), Expect = 3e-15 Identities = 48/73 (65%), Positives = 57/73 (78%), Gaps = 8/73 (10%) Frame = +3 Query: 123 MLLRSSSSPILNSWMPNSS--TGFASCSSPDSDSLPQLTRTRSFSLSMSSEDGTGRSSPT 296 MLLRSSS+PILNSW+ NS+ +G S SSP+SDSLPQLTR RSFSL++ SE+G GRS+PT Sbjct: 1 MLLRSSSTPILNSWLHNSTAGSGSGSGSSPESDSLPQLTRARSFSLTVCSEEGLGRSNPT 60 Query: 297 R------FDSDLK 317 FDSDLK Sbjct: 61 ATPTRHVFDSDLK 73 >gb|EPS66873.1| hypothetical protein M569_07905, partial [Genlisea aurea] Length = 257 Score = 68.9 bits (167), Expect = 7e-10 Identities = 35/63 (55%), Positives = 48/63 (76%) Frame = +3 Query: 123 MLLRSSSSPILNSWMPNSSTGFASCSSPDSDSLPQLTRTRSFSLSMSSEDGTGRSSPTRF 302 MLLRSSS+PILNSW+PNS +GF SS +S++LP+L RTRS SL+ ++G G+++P R Sbjct: 1 MLLRSSSTPILNSWIPNSVSGFG--SSLESEALPRLIRTRSVSLTTPFDEGFGKTTPMRI 58 Query: 303 DSD 311 D Sbjct: 59 ACD 61 >gb|EYU24640.1| hypothetical protein MIMGU_mgv1a011374mg [Mimulus guttatus] Length = 283 Score = 65.5 bits (158), Expect = 7e-09 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 2/67 (2%) Frame = +3 Query: 123 MLLRSSSSPILNSWMPNSSTGFASCSSPDSDSLPQLTRTRSFSLSMSSEDGTGRSSPTR- 299 MLLRSSS+PILN W+P S++G S SSP+ D+LPQL RT S L+ S E+ +GR +P + Sbjct: 1 MLLRSSSAPILNPWLPISASG--SGSSPEPDTLPQLKRTPSLCLTTSFEEFSGRITPKKL 58 Query: 300 -FDSDLK 317 FDS+ K Sbjct: 59 VFDSESK 65