BLASTX nr result
ID: Mentha24_contig00000245
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00000245 (477 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67742.1| hypothetical protein M569_07033 [Genlisea aurea] 62 6e-08 gb|AEQ94178.1| auxin-repressed protein [Elaeis guineensis] 61 1e-07 gb|ABW74471.1| auxin-repressed protein [Paeonia suffruticosa] 61 2e-07 gb|EYU43381.1| hypothetical protein MIMGU_mgv1a016425mg [Mimulus... 60 4e-07 gb|AAK25768.1|AF336307_1 auxin-repressed protein like-protein [M... 60 4e-07 dbj|BAM15888.1| putative auxin-repressed protein, partial [Pyrus... 60 4e-07 sp|Q05349.1|12KD_FRAAN RecName: Full=Auxin-repressed 12.5 kDa pr... 59 5e-07 gb|AHA92828.1| DRM1 protein [Rosa hybrid cultivar] 59 5e-07 ref|XP_004293871.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 59 5e-07 gb|AAX84678.1| auxin-repressed protein-like protein ARP2 [Maniho... 59 7e-07 gb|AAX84677.1| auxin-repressed protein-like protein ARP1 [Maniho... 59 7e-07 gb|AAS76635.1| auxin-repressed protein [Nicotiana tabacum] 59 9e-07 gb|ABR15095.1| dormancy-associated protein/auxin-repressed prote... 59 9e-07 gb|AAS75891.1| auxin-repressed protein [Solanum virginianum] 59 9e-07 ref|XP_006347006.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 58 1e-06 ref|NP_001275209.1| auxin-repressed 12.5 kDa protein-like [Solan... 58 1e-06 gb|ADO32740.1| auxin-repressed protein [Camellia sinensis] 58 1e-06 gb|ABK95255.1| unknown [Populus trichocarpa] gi|118487490|gb|ABK... 58 1e-06 ref|XP_004232909.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 58 1e-06 gb|AAW02792.1| dormancy-associated protein [Codonopsis lanceolata] 58 1e-06 >gb|EPS67742.1| hypothetical protein M569_07033 [Genlisea aurea] Length = 117 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 477 VGAHYFDNPEPNSPTVYDWLYSGETRSKH 391 +GA YFD P+PNSPTVYDWLYSGETRSKH Sbjct: 88 IGADYFDRPQPNSPTVYDWLYSGETRSKH 116 >gb|AEQ94178.1| auxin-repressed protein [Elaeis guineensis] Length = 123 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 477 VGAHYFDNPEPNSPTVYDWLYSGETRSKH 391 +GA+YFD P+PNSPTVYDWLYSGETRS H Sbjct: 94 IGANYFDKPQPNSPTVYDWLYSGETRSNH 122 >gb|ABW74471.1| auxin-repressed protein [Paeonia suffruticosa] Length = 126 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 477 VGAHYFDNPEPNSPTVYDWLYSGETRSKHH 388 +G++ FD P+PNSPTVYDWLYSG+TRSKHH Sbjct: 96 IGSNVFDKPQPNSPTVYDWLYSGDTRSKHH 125 >gb|EYU43381.1| hypothetical protein MIMGU_mgv1a016425mg [Mimulus guttatus] Length = 122 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 477 VGAHYFDNPEPNSPTVYDWLYSGETRSKH 391 +G YFD P+PNSPTVYDWLYSG+TRSKH Sbjct: 93 IGTDYFDKPQPNSPTVYDWLYSGDTRSKH 121 >gb|AAK25768.1|AF336307_1 auxin-repressed protein like-protein [Malus domestica] Length = 114 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 477 VGAHYFDNPEPNSPTVYDWLYSGETRSKHH 388 +G FD P+PNSPTVYDWLYSGETRSKHH Sbjct: 84 MGNQVFDKPQPNSPTVYDWLYSGETRSKHH 113 >dbj|BAM15888.1| putative auxin-repressed protein, partial [Pyrus pyrifolia var. culta] Length = 63 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 477 VGAHYFDNPEPNSPTVYDWLYSGETRSKHH 388 +G FD P+PNSPTVYDWLYSGETRSKHH Sbjct: 33 MGNQVFDKPQPNSPTVYDWLYSGETRSKHH 62 >sp|Q05349.1|12KD_FRAAN RecName: Full=Auxin-repressed 12.5 kDa protein gi|22573|emb|CAA36676.1| 12.5 kDa protein [Fragaria x ananassa] gi|927034|gb|AAA73872.1| auxin-repressed protein [Fragaria x ananassa] Length = 111 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 477 VGAHYFDNPEPNSPTVYDWLYSGETRSKHH 388 +G FD+P+PNSPTVYDW+YSGETRSKHH Sbjct: 81 MGNQVFDSPQPNSPTVYDWMYSGETRSKHH 110 >gb|AHA92828.1| DRM1 protein [Rosa hybrid cultivar] Length = 112 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 477 VGAHYFDNPEPNSPTVYDWLYSGETRSKHH 388 +G FD+P+PNSPTVYDW+YSGETRSKHH Sbjct: 82 MGNQVFDSPQPNSPTVYDWMYSGETRSKHH 111 >ref|XP_004293871.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform 2 [Fragaria vesca subsp. vesca] Length = 114 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 477 VGAHYFDNPEPNSPTVYDWLYSGETRSKHH 388 +G FD+P+PNSPTVYDW+YSGETRSKHH Sbjct: 84 MGNQVFDSPQPNSPTVYDWMYSGETRSKHH 113 >gb|AAX84678.1| auxin-repressed protein-like protein ARP2 [Manihot esculenta] Length = 68 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 477 VGAHYFDNPEPNSPTVYDWLYSGETRSKH 391 +GA FD P+PNSPTVYDWLYSGETRSKH Sbjct: 39 LGAQLFDKPQPNSPTVYDWLYSGETRSKH 67 >gb|AAX84677.1| auxin-repressed protein-like protein ARP1 [Manihot esculenta] Length = 117 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 477 VGAHYFDNPEPNSPTVYDWLYSGETRSKH 391 +GA FD P+PNSPTVYDWLYSGETRSKH Sbjct: 88 LGAQLFDKPQPNSPTVYDWLYSGETRSKH 116 >gb|AAS76635.1| auxin-repressed protein [Nicotiana tabacum] Length = 124 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/34 (73%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = -1 Query: 477 VGAHYFDNPE-PNSPTVYDWLYSGETRSKHHEKV 379 +GA FD P PN+PTVYDWLYSG TRSKHHEK+ Sbjct: 91 IGAEVFDKPSHPNAPTVYDWLYSGNTRSKHHEKL 124 >gb|ABR15095.1| dormancy-associated protein/auxin-repressed protein [Glycyrrhiza uralensis] Length = 114 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 477 VGAHYFDNPEPNSPTVYDWLYSGETRSKH 391 +GA YFD P PN+PTVYDWLYSG+TRSKH Sbjct: 85 IGAEYFDKPLPNTPTVYDWLYSGDTRSKH 113 >gb|AAS75891.1| auxin-repressed protein [Solanum virginianum] Length = 124 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/34 (73%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = -1 Query: 477 VGAHYFDNPE-PNSPTVYDWLYSGETRSKHHEKV 379 +GA FD P PN+PTVYDWLYSG TRSKHHEK+ Sbjct: 91 IGAEVFDKPSHPNAPTVYDWLYSGNTRSKHHEKL 124 >ref|XP_006347006.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Solanum tuberosum] Length = 123 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/33 (75%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Frame = -1 Query: 477 VGAHYFDNPE-PNSPTVYDWLYSGETRSKHHEK 382 +GA FD P PN+PTVYDWLYSG TRSKHHEK Sbjct: 90 IGAEVFDKPSHPNAPTVYDWLYSGNTRSKHHEK 122 >ref|NP_001275209.1| auxin-repressed 12.5 kDa protein-like [Solanum tuberosum] gi|413968576|gb|AFW90625.1| auxin repressed/dormancy associated protein [Solanum tuberosum] Length = 124 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/33 (75%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Frame = -1 Query: 477 VGAHYFDNPE-PNSPTVYDWLYSGETRSKHHEK 382 +GA FD P PN+PTVYDWLYSG TRSKHHEK Sbjct: 91 IGAEVFDKPSHPNAPTVYDWLYSGNTRSKHHEK 123 >gb|ADO32740.1| auxin-repressed protein [Camellia sinensis] Length = 118 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 477 VGAHYFDNPEPNSPTVYDWLYSGETRSKH 391 +G+ FD P+PNSPTVYDWLYSGETRSKH Sbjct: 89 IGSDVFDKPQPNSPTVYDWLYSGETRSKH 117 >gb|ABK95255.1| unknown [Populus trichocarpa] gi|118487490|gb|ABK95572.1| unknown [Populus trichocarpa] gi|118489546|gb|ABK96575.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489918|gb|ABK96756.1| unknown [Populus trichocarpa x Populus deltoides] Length = 123 Score = 58.2 bits (139), Expect = 1e-06 Identities = 21/29 (72%), Positives = 27/29 (93%) Frame = -1 Query: 477 VGAHYFDNPEPNSPTVYDWLYSGETRSKH 391 +GAH FD P+PN+PTVYDW+YSGET+S+H Sbjct: 94 IGAHVFDKPQPNTPTVYDWMYSGETKSEH 122 >ref|XP_004232909.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform 2 [Solanum lycopersicum] gi|111183163|gb|ABH07900.1| auxin repressed/dormancy associated protein [Solanum lycopersicum] Length = 123 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/33 (75%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Frame = -1 Query: 477 VGAHYFDNPE-PNSPTVYDWLYSGETRSKHHEK 382 +GA FD P PN+PTVYDWLYSG TRSKHHEK Sbjct: 90 IGAEVFDKPSHPNAPTVYDWLYSGNTRSKHHEK 122 >gb|AAW02792.1| dormancy-associated protein [Codonopsis lanceolata] Length = 119 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 477 VGAHYFDNPEPNSPTVYDWLYSGETRSKH 391 +G+ FD PEPNSPTVYDWLYSGETRSKH Sbjct: 90 LGSALFDKPEPNSPTVYDWLYSGETRSKH 118