BLASTX nr result
ID: Mentha24_contig00000014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00000014 (625 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59999.1| hypothetical protein M569_14806, partial [Genlise... 103 4e-20 >gb|EPS59999.1| hypothetical protein M569_14806, partial [Genlisea aurea] Length = 74 Score = 103 bits (257), Expect = 4e-20 Identities = 49/59 (83%), Positives = 53/59 (89%) Frame = +3 Query: 219 KLSTITALLRGNRPVTHVRALRRKGCVSETNPSPHGGRGALPSEGGSPSDLLFLAGGGY 395 +LSTITA+ R RP+ HVRA+RRKGCV TNPSPHGGRGALPSEGGSPSDLLFLAGGGY Sbjct: 13 RLSTITAISRVIRPIIHVRAVRRKGCVIGTNPSPHGGRGALPSEGGSPSDLLFLAGGGY 71