BLASTX nr result
ID: Mentha23_contig00048225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00048225 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43972.1| hypothetical protein MIMGU_mgv1a020545mg [Mimulus... 60 2e-07 >gb|EYU43972.1| hypothetical protein MIMGU_mgv1a020545mg [Mimulus guttatus] Length = 1087 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +1 Query: 235 NNSVVGETSKFSIFMRDAYLYPSPVHLEVLQVRIMQVSD 351 NNSV GET +FS+F++DAYLYPSPV LE L+V+IM SD Sbjct: 373 NNSVAGETERFSVFLKDAYLYPSPVELESLRVQIMHESD 411