BLASTX nr result
ID: Mentha23_contig00047510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00047510 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 56 5e-06 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 56.2 bits (134), Expect = 5e-06 Identities = 37/104 (35%), Positives = 52/104 (50%), Gaps = 6/104 (5%) Frame = +1 Query: 10 QVEIYSLKSNTWKQNFSFPNCGEHVFKS---GTYVDSKCYWILSKRLS--VLWFDFEKES 174 QVE+YSLKS++WK+ S P H + S YV+ YW + +L FD E Sbjct: 192 QVELYSLKSDSWKE-ISVPEA--HPYASPLFNNYVNGSYYWQATGNSDYLILSFDMANEK 248 Query: 175 FSSIPLPKIKEG-SDCLLDLHEYKGSLVVIGYERSGLNRCFEAW 303 FS++PLP + L L ++ GSL I Y R G + + W Sbjct: 249 FSTLPLPTFGGSLAQYYLQLLDFNGSLGAIVYPREGTEKSIDLW 292