BLASTX nr result
ID: Mentha23_contig00047503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00047503 (354 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23295.1| hypothetical protein MIMGU_mgv1a001533mg [Mimulus... 36 6e-08 >gb|EYU23295.1| hypothetical protein MIMGU_mgv1a001533mg [Mimulus guttatus] Length = 801 Score = 35.8 bits (81), Expect(3) = 6e-08 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = +1 Query: 190 PRFLTRRLLMFALKCSISFGFAVFFGVTCSTE 285 P + ++ LM ALKC++S GFAVFFG S E Sbjct: 384 PITINKKRLMPALKCALSLGFAVFFGSIYSKE 415 Score = 33.1 bits (74), Expect(3) = 6e-08 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = +3 Query: 87 NYKFLQTRHP----APINLKDLTFLFFLFCFKSSTQNHAKIPH 203 N KFLQT H I+ KDL LFF+FC K ++ P+ Sbjct: 326 NNKFLQTLHANTIIPSISFKDLPSLFFIFCLKLLQTKSSQAPN 368 Score = 32.7 bits (73), Expect(3) = 6e-08 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = +2 Query: 272 HAAQNVFWYELPVALSLASAREVMFKI 352 ++ ++ FW LPVA+SLA++RE FK+ Sbjct: 412 YSKEDGFWSGLPVAISLAASREATFKV 438