BLASTX nr result
ID: Mentha23_contig00047087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00047087 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR15420.1| geranyl pyrophosphate synthase large subunit [Men... 89 5e-16 gb|AAF08793.1|AF182828_1 geranyl diphosphate synthase large subu... 87 2e-15 >gb|ABR15420.1| geranyl pyrophosphate synthase large subunit [Mentha canadensis] Length = 377 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/55 (78%), Positives = 45/55 (81%) Frame = -2 Query: 165 MSVLVDPVTKWPQTIGVKDVHXXXXXXXXSTLFLSHPLRTEMPFSLYFSSPLKAP 1 MS LV+PV KWPQTIG+KDVH STLFLSHPLRTEMPFSLYFSSPLKAP Sbjct: 1 MSALVNPVAKWPQTIGIKDVHGGRRRRSRSTLFLSHPLRTEMPFSLYFSSPLKAP 55 >gb|AAF08793.1|AF182828_1 geranyl diphosphate synthase large subunit [Mentha x piperita] gi|10637876|emb|CAC10561.1| gpp synthase large subunit [Mentha x piperita] gi|158979013|gb|ABW86879.1| geranyl pyrophosphate synthase large subunit [Mentha x piperita] Length = 377 Score = 87.4 bits (215), Expect = 2e-15 Identities = 43/55 (78%), Positives = 44/55 (80%) Frame = -2 Query: 165 MSVLVDPVTKWPQTIGVKDVHXXXXXXXXSTLFLSHPLRTEMPFSLYFSSPLKAP 1 MS LV+PV KWPQTIGVKDVH STLF SHPLRTEMPFSLYFSSPLKAP Sbjct: 1 MSALVNPVAKWPQTIGVKDVHGGRRRRSRSTLFQSHPLRTEMPFSLYFSSPLKAP 55