BLASTX nr result
ID: Mentha23_contig00046846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00046846 (402 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004335509.1| thioredoxin-1, putative [Acanthamoeba castel... 78 1e-12 ref|XP_004335504.1| thioredoxin, putative [Acanthamoeba castella... 78 1e-12 gb|EFX83063.1| hypothetical protein DAPPUDRAFT_230730 [Daphnia p... 77 2e-12 gb|AGC96525.1| thioredoxin 1 [Scylla paramamosain] 75 9e-12 gb|AAF14217.1|AF107490_1 thioredoxin [Fasciola hepatica] 74 2e-11 pdb|2VIM|A Chain A, X-Ray Structure Of Fasciola Hepatica Thiored... 74 2e-11 dbj|BAN20116.1| thioredoxin, putative [Riptortus pedestris] 74 3e-11 ref|XP_003396074.1| PREDICTED: thioredoxin-2-like [Bombus terres... 73 4e-11 emb|CAE54169.1| thioredoxin-1 [Mesobuthus gibbosus] 73 4e-11 emb|CAE54136.1| thioredoxin-1 [Mesobuthus gibbosus] 73 4e-11 emb|CAE54152.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869087|... 73 4e-11 emb|CAE54157.1| thioredoxin-1 [Mesobuthus gibbosus] 73 4e-11 emb|CAE54127.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869037|... 73 4e-11 emb|CAE54137.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869065|... 73 4e-11 gb|AGF33352.1| thioredoxin [Apis cerana] 73 5e-11 ref|XP_003250408.1| PREDICTED: thioredoxin-2 isoform 1 [Apis mel... 73 5e-11 ref|NP_001002461.1| thioredoxin [Danio rerio] gi|49903111|gb|AAH... 73 5e-11 pdb|2YPM|A Chain A, Crystal Structure Of Ancestral Thioredoxin R... 72 6e-11 ref|NP_001091381.1| uncharacterized protein LOC100037235 [Xenopu... 72 6e-11 ref|NP_001091804.1| thioredoxin-like protein [Bombyx mori] gi|11... 72 6e-11 >ref|XP_004335509.1| thioredoxin-1, putative [Acanthamoeba castellanii str. Neff] gi|440792268|gb|ELR13496.1| thioredoxin-1, putative [Acanthamoeba castellanii str. Neff] Length = 105 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/66 (54%), Positives = 48/66 (72%) Frame = -2 Query: 401 PTVEKMAVENADVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLRE 222 P +EKM+ EN +VVFLKVDVDE D A+ V MPTF+F KNG K+ E+ GA+E+K+ E Sbjct: 40 PAIEKMSQENTNVVFLKVDVDEVGDLAAELSVSAMPTFLFFKNGSKVHEVVGASEAKIAE 99 Query: 221 AITTNK 204 IT ++ Sbjct: 100 GITKHQ 105 >ref|XP_004335504.1| thioredoxin, putative [Acanthamoeba castellanii str. Neff] gi|440792263|gb|ELR13491.1| thioredoxin, putative [Acanthamoeba castellanii str. Neff] Length = 718 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/66 (54%), Positives = 48/66 (72%) Frame = -2 Query: 401 PTVEKMAVENADVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLRE 222 P +EKM+ EN +VVFLKVDVDE D A+ V MPTF+F KNG K+ E+ GA+E+K+ E Sbjct: 653 PAIEKMSQENTNVVFLKVDVDEVGDLAAELSVSAMPTFLFFKNGSKVHEVVGASEAKIAE 712 Query: 221 AITTNK 204 IT ++ Sbjct: 713 GITKHQ 718 >gb|EFX83063.1| hypothetical protein DAPPUDRAFT_230730 [Daphnia pulex] Length = 105 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/66 (54%), Positives = 47/66 (71%) Frame = -2 Query: 401 PTVEKMAVENADVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLRE 222 P +E M+ E +VVF+KVDVDE ED AS Y + MPTF++LKNG K+ E GANE +LR+ Sbjct: 40 PKIEAMSKELPNVVFVKVDVDECEDVASDYNISCMPTFLYLKNGAKVAEFSGANEEQLRK 99 Query: 221 AITTNK 204 I +K Sbjct: 100 LIDQHK 105 >gb|AGC96525.1| thioredoxin 1 [Scylla paramamosain] Length = 105 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/66 (54%), Positives = 47/66 (71%) Frame = -2 Query: 401 PTVEKMAVENADVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLRE 222 P +++M+ + +DVVFLKVDVDE+E+ A Y V MPTFIF+K GKK+ GA+E KLRE Sbjct: 40 PKIQEMSEQMSDVVFLKVDVDESEEVAMAYQVSCMPTFIFIKEGKKVDSFSGASEDKLRE 99 Query: 221 AITTNK 204 I K Sbjct: 100 FIARLK 105 >gb|AAF14217.1|AF107490_1 thioredoxin [Fasciola hepatica] Length = 104 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/66 (53%), Positives = 47/66 (71%) Frame = -2 Query: 401 PTVEKMAVENADVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLRE 222 P VE +A E +V F KVDVD+ E+ A+ Y V MPTF+F+K+GK++ GANE+KLRE Sbjct: 39 PKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRE 98 Query: 221 AITTNK 204 IT +K Sbjct: 99 TITRHK 104 >pdb|2VIM|A Chain A, X-Ray Structure Of Fasciola Hepatica Thioredoxin gi|6687568|emb|CAB65014.1| thioredoxin (TRX) [Fasciola hepatica] Length = 104 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/66 (53%), Positives = 47/66 (71%) Frame = -2 Query: 401 PTVEKMAVENADVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLRE 222 P VE +A E +V F KVDVD+ E+ A+ Y V MPTF+F+K+GK++ GANE+KLRE Sbjct: 39 PKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRE 98 Query: 221 AITTNK 204 IT +K Sbjct: 99 TITRHK 104 >dbj|BAN20116.1| thioredoxin, putative [Riptortus pedestris] Length = 105 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/66 (53%), Positives = 44/66 (66%) Frame = -2 Query: 401 PTVEKMAVENADVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLRE 222 P E++A N DVVFLKVDVDE E A+ Y + VMPTF+F+KN K+ G NE KL+E Sbjct: 40 PKYEELATSNPDVVFLKVDVDECEAIAAQYEISVMPTFVFIKNKVKVESFSGGNEEKLKE 99 Query: 221 AITTNK 204 I +K Sbjct: 100 FIQKHK 105 >ref|XP_003396074.1| PREDICTED: thioredoxin-2-like [Bombus terrestris] Length = 105 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/66 (51%), Positives = 45/66 (68%) Frame = -2 Query: 401 PTVEKMAVENADVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLRE 222 P +E+++ E +V+FLKVDVDE ED AS YG+ MPTF+F+KN K L GAN KL+ Sbjct: 40 PKLEELSKEMENVIFLKVDVDECEDIASEYGISSMPTFVFIKNSKVLETFSGANYDKLKS 99 Query: 221 AITTNK 204 I +K Sbjct: 100 TIQKHK 105 >emb|CAE54169.1| thioredoxin-1 [Mesobuthus gibbosus] Length = 126 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = -2 Query: 401 PTVEKMAVENA-DVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLR 225 P +EK+ EN+ +VVFLKVDVDE E+ A T+ V MPTFI LKN K+ E GAN+ KLR Sbjct: 57 PFIEKLEQENSGNVVFLKVDVDENEELAQTFNVSCMPTFILLKNRNKVDEFSGANQEKLR 116 Query: 224 EAITTNK 204 E + +K Sbjct: 117 EMVDKHK 123 >emb|CAE54136.1| thioredoxin-1 [Mesobuthus gibbosus] Length = 126 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = -2 Query: 401 PTVEKMAVENA-DVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLR 225 P +EK+ EN+ +VVFLKVDVDE E+ A T+ V MPTFI LKN K+ E GAN+ KLR Sbjct: 57 PFIEKLEQENSGNVVFLKVDVDENEELAQTFNVSCMPTFILLKNRNKVDEFSGANQEKLR 116 Query: 224 EAITTNK 204 E + +K Sbjct: 117 EMVDKHK 123 >emb|CAE54152.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869087|emb|CAE54153.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869091|emb|CAE54155.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869093|emb|CAE54156.1| thioredoxin-1 [Mesobuthus gibbosus] Length = 126 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = -2 Query: 401 PTVEKMAVENA-DVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLR 225 P +EK+ EN+ +VVFLKVDVDE E+ A T+ V MPTFI LKN K+ E GAN+ KLR Sbjct: 57 PFIEKLEQENSGNVVFLKVDVDENEELAQTFNVSCMPTFILLKNRNKVDEFSGANQEKLR 116 Query: 224 EAITTNK 204 E + +K Sbjct: 117 EMVDKHK 123 >emb|CAE54157.1| thioredoxin-1 [Mesobuthus gibbosus] Length = 126 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = -2 Query: 401 PTVEKMAVENA-DVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLR 225 P +EK+ EN+ +VVFLKVDVDE E+ A T+ V MPTFI LKN K+ E GAN+ KLR Sbjct: 57 PFIEKLEQENSGNVVFLKVDVDENEELAQTFNVSCMPTFILLKNRNKVDEFSGANQEKLR 116 Query: 224 EAITTNK 204 E + +K Sbjct: 117 EMVDKHK 123 >emb|CAE54127.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869037|emb|CAE54128.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869041|emb|CAE54130.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869043|emb|CAE54131.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869047|emb|CAE54133.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869049|emb|CAE54134.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869051|emb|CAE54135.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869057|emb|CAE54138.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869059|emb|CAE54139.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869061|emb|CAE54140.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869063|emb|CAE54141.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869073|emb|CAE54146.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869075|emb|CAE54147.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869077|emb|CAE54148.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869079|emb|CAE54149.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869081|emb|CAE54150.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869083|emb|CAE54151.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869097|emb|CAE54158.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869099|emb|CAE54159.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869101|emb|CAE54160.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869103|emb|CAE54161.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869105|emb|CAE54162.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869107|emb|CAE54163.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869109|emb|CAE54164.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869135|emb|CAE54177.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869139|emb|CAE54179.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869141|emb|CAE54180.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869143|emb|CAE54181.1| thioredoxin-1 [Mesobuthus gibbosus] Length = 126 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = -2 Query: 401 PTVEKMAVENA-DVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLR 225 P +EK+ EN+ +VVFLKVDVDE E+ A T+ V MPTFI LKN K+ E GAN+ KLR Sbjct: 57 PFIEKLEQENSGNVVFLKVDVDENEELAQTFNVSCMPTFILLKNRNKVDEFSGANQEKLR 116 Query: 224 EAITTNK 204 E + +K Sbjct: 117 EMVDKHK 123 >emb|CAE54137.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869065|emb|CAE54142.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869069|emb|CAE54144.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869071|emb|CAE54145.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869113|emb|CAE54166.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869115|emb|CAE54167.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869117|emb|CAE54168.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869121|emb|CAE54170.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869123|emb|CAE54171.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869125|emb|CAE54172.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869127|emb|CAE54173.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869129|emb|CAE54174.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869131|emb|CAE54175.1| thioredoxin-1 [Mesobuthus gibbosus] gi|51869137|emb|CAE54178.1| thioredoxin-1 [Mesobuthus gibbosus] Length = 126 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = -2 Query: 401 PTVEKMAVENA-DVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLR 225 P +EK+ EN+ +VVFLKVDVDE E+ A T+ V MPTFI LKN K+ E GAN+ KLR Sbjct: 57 PFIEKLEQENSGNVVFLKVDVDENEELAQTFNVSCMPTFILLKNRNKVDEFSGANQEKLR 116 Query: 224 EAITTNK 204 E + +K Sbjct: 117 EMVDKHK 123 >gb|AGF33352.1| thioredoxin [Apis cerana] Length = 105 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/66 (51%), Positives = 44/66 (66%) Frame = -2 Query: 401 PTVEKMAVENADVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLRE 222 P VE++++E DV+FLKVDVDE ED A Y + MPTF+F+KN K L GAN KL+ Sbjct: 40 PKVEELSMEMEDVIFLKVDVDECEDIAGEYEITSMPTFVFIKNNKVLENFSGANYDKLKS 99 Query: 221 AITTNK 204 I +K Sbjct: 100 TIQKHK 105 >ref|XP_003250408.1| PREDICTED: thioredoxin-2 isoform 1 [Apis mellifera] Length = 105 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/66 (51%), Positives = 44/66 (66%) Frame = -2 Query: 401 PTVEKMAVENADVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLRE 222 P VE++++E DV+FLKVDVDE ED A Y + MPTF+F+KN K L GAN KL+ Sbjct: 40 PKVEELSMEMEDVIFLKVDVDECEDIAGEYEITSMPTFVFIKNNKVLENFSGANYDKLKS 99 Query: 221 AITTNK 204 I +K Sbjct: 100 TIQKHK 105 >ref|NP_001002461.1| thioredoxin [Danio rerio] gi|49903111|gb|AAH76358.1| Zgc:92903 [Danio rerio] gi|182891398|gb|AAI64445.1| Zgc:92903 protein [Danio rerio] Length = 107 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/58 (58%), Positives = 44/58 (75%) Frame = -2 Query: 377 ENADVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLREAITTNK 204 EN +VVFLKVDVD+A+D A+ G+ MPTF F KNGKK+ E G+N+SKL E I ++K Sbjct: 50 ENKNVVFLKVDVDDAQDVAALCGISCMPTFHFYKNGKKVDEFSGSNQSKLEEKINSHK 107 >pdb|2YPM|A Chain A, Crystal Structure Of Ancestral Thioredoxin Relative To Last Animal And Fungi Common Ancestor (lafca) From The Precambrian Period Length = 106 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/63 (57%), Positives = 45/63 (71%), Gaps = 1/63 (1%) Frame = -2 Query: 401 PTVEKMAVENAD-VVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLR 225 P E+++ E D VVFLKVDVDE ED A+ YG+ MPTF F KNGKK+ E+ GAN+ KL+ Sbjct: 39 PKFEELSEEYPDNVVFLKVDVDEVEDVAAEYGISAMPTFQFFKNGKKVDELTGANQEKLK 98 Query: 224 EAI 216 I Sbjct: 99 AMI 101 >ref|NP_001091381.1| uncharacterized protein LOC100037235 [Xenopus laevis] gi|125858686|gb|AAI29795.1| LOC100037235 protein [Xenopus laevis] Length = 105 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/66 (56%), Positives = 45/66 (68%) Frame = -2 Query: 401 PTVEKMAVENADVVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLRE 222 P EK++VEN DVVFLKVDVD+A+D A+ V MPTF F KNG K+ E GANES L + Sbjct: 40 PVFEKLSVENPDVVFLKVDVDDAQDVAAHCEVKCMPTFHFYKNGLKVFEFSGANESSLVQ 99 Query: 221 AITTNK 204 + K Sbjct: 100 KVAELK 105 >ref|NP_001091804.1| thioredoxin-like protein [Bombyx mori] gi|116272511|gb|ABJ97191.1| thioredoxin-like protein [Bombyx mori] gi|124127033|gb|ABM92269.1| thioredoxin [Bombyx mori] Length = 106 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/67 (52%), Positives = 48/67 (71%), Gaps = 1/67 (1%) Frame = -2 Query: 401 PTVEKMAVENAD-VVFLKVDVDEAEDCASTYGVDVMPTFIFLKNGKKLTEIKGANESKLR 225 P ++++A E +D +V +KVDVDE ED AS Y ++ MPTF+F+KNGKKL E GAN KL+ Sbjct: 40 PKLDEIAAEMSDSIVVVKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGANVDKLK 99 Query: 224 EAITTNK 204 I +K Sbjct: 100 TTILKHK 106