BLASTX nr result
ID: Mentha23_contig00046803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00046803 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21249.1| hypothetical protein MIMGU_mgv1a008830mg [Mimulus... 63 4e-08 >gb|EYU21249.1| hypothetical protein MIMGU_mgv1a008830mg [Mimulus guttatus] Length = 361 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/54 (55%), Positives = 39/54 (72%), Gaps = 5/54 (9%) Frame = +1 Query: 187 NFISCCLQGKPARRLSTAQLLKVPLIVQYSSPGSGGS-----NMVHHQAHQLLP 333 +FI+CCLQ +PA+R + QLL+ P I+QY SPGS GS N + HQ+HQLLP Sbjct: 300 DFIACCLQREPAKRWTAGQLLRHPFILQYVSPGSNGSGGSGGNSLQHQSHQLLP 353