BLASTX nr result
ID: Mentha23_contig00046794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00046794 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002440839.1| hypothetical protein SORBIDRAFT_09g008060 [S... 41 4e-07 >ref|XP_002440839.1| hypothetical protein SORBIDRAFT_09g008060 [Sorghum bicolor] gi|241946124|gb|EES19269.1| hypothetical protein SORBIDRAFT_09g008060 [Sorghum bicolor] Length = 483 Score = 40.8 bits (94), Expect(3) = 4e-07 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = +2 Query: 299 LRKMNKYKFVFVMHLMRHLLGITNELS 379 L +M K++FVF+MHLM LLGITN+LS Sbjct: 182 LLQMEKFEFVFIMHLMIRLLGITNDLS 208 Score = 29.6 bits (65), Expect(3) = 4e-07 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +3 Query: 45 SCKIRDQLKMLEHERLVKDLDDSKRVSGKISKLGDQFD*TWNTRW 179 SCK RDQ+ H+ +V L+ + SG+ + +TRW Sbjct: 98 SCKRRDQIAQSHHDNIVNQLESCQIFSGRGKNQETRVARAGDTRW 142 Score = 28.1 bits (61), Expect(3) = 4e-07 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +1 Query: 214 MWPSVEKVLDNVRDDNTCADAKGTTRGMLKKNE 312 MW SV +VL+N+ +D D + TT G+L + E Sbjct: 155 MWDSVLEVLENIVEDGV-GDKRTTTSGLLLQME 186