BLASTX nr result
ID: Mentha23_contig00046770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00046770 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGL45958.1| small heat shock protein 35.9 [Boea hygrometrica] 66 4e-09 gb|EYU30531.1| hypothetical protein MIMGU_mgv1a018870mg, partial... 62 8e-08 >gb|AGL45958.1| small heat shock protein 35.9 [Boea hygrometrica] Length = 317 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +3 Query: 45 KFLGGNKWSRFLEDYEVPENSDMNSVRAMFHEGALTITIPKKIVDK 182 + + GNKWSRF ED++VPEN +MNS+RA G LTIT+PKK VDK Sbjct: 70 RLVAGNKWSRFQEDFQVPENCEMNSIRAKHQGGNLTITVPKKNVDK 115 >gb|EYU30531.1| hypothetical protein MIMGU_mgv1a018870mg, partial [Mimulus guttatus] Length = 190 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/53 (52%), Positives = 38/53 (71%), Gaps = 3/53 (5%) Frame = +3 Query: 30 NSVRAK---FLGGNKWSRFLEDYEVPENSDMNSVRAMFHEGALTITIPKKIVD 179 N++R + +GGNKWSRFLE+++VP+N +MNS+RA F G L ITI K D Sbjct: 67 NTIRVRGERLVGGNKWSRFLENFQVPQNGEMNSIRAKFQGGTLNITISKSKTD 119