BLASTX nr result
ID: Mentha23_contig00046746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00046746 (493 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37073.1| hypothetical protein MIMGU_mgv1a013649mg [Mimulus... 68 1e-09 >gb|EYU37073.1| hypothetical protein MIMGU_mgv1a013649mg [Mimulus guttatus] Length = 214 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/53 (62%), Positives = 43/53 (81%) Frame = -2 Query: 312 ANRRFAAQSVTTVCAASKRNRYGIAKSGKLMLESAFIIASHLRILPEPVELLL 154 +N + A +CAA++RNRYGI KSGKL+L+SAFIIAS LR+LPEP+EL+L Sbjct: 32 SNSQPRAAEPKILCAANRRNRYGIGKSGKLILDSAFIIASKLRLLPEPLELIL 84