BLASTX nr result
ID: Mentha23_contig00046662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00046662 (374 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002462032.1| hypothetical protein SORBIDRAFT_02g013090 [S... 56 6e-06 ref|XP_002467291.1| hypothetical protein SORBIDRAFT_01g023040 [S... 55 8e-06 >ref|XP_002462032.1| hypothetical protein SORBIDRAFT_02g013090 [Sorghum bicolor] gi|241925409|gb|EER98553.1| hypothetical protein SORBIDRAFT_02g013090 [Sorghum bicolor] Length = 849 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/49 (46%), Positives = 31/49 (63%) Frame = -1 Query: 323 EGKLALYFHHGGKFTHIGGARFYVGGSYARKAIDADKTGYLEVVGMIKD 177 + + + FH GG FT +GGA+FYVGG A ID DK Y E++G + D Sbjct: 2 DDSICIRFHFGGSFTSVGGAQFYVGGDNAESWIDMDKLSYFEILGHLSD 50 >ref|XP_002467291.1| hypothetical protein SORBIDRAFT_01g023040 [Sorghum bicolor] gi|241921145|gb|EER94289.1| hypothetical protein SORBIDRAFT_01g023040 [Sorghum bicolor] Length = 934 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/49 (48%), Positives = 31/49 (63%) Frame = -1 Query: 323 EGKLALYFHHGGKFTHIGGARFYVGGSYARKAIDADKTGYLEVVGMIKD 177 + + + FH GG FT +GGA+FYVGG A ID DK Y EV+G + D Sbjct: 2 DDSICIRFHFGGSFTRVGGAQFYVGGDNAESWIDMDKLSYFEVLGHLFD 50